Recombinant Human NOMO2 protein, His-tagged
Cat.No. : | NOMO2-3404H |
Product Overview : | Recombinant Human NOMO2 protein(873-1222 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 873-1222 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | YALAGVSFEIKAEDDQPLPGVLLSLSGGLFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTAYSCYGTVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKSENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYILPQVSFTAVGYHKHITLIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVGALGQAASDNSGPEDAKRQAKKQKTRRT |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NOMO2 NODAL modulator 2 [ Homo sapiens (human) ] |
Official Symbol | NOMO2 |
Synonyms | NOMO2; PM5; Nomo; NODAL modulator 2; nodal modulator 2; pM5 protein 2; pM5 protein, centromeric copy |
Gene ID | 283820 |
mRNA Refseq | NM_001004060 |
Protein Refseq | NP_001004060 |
MIM | 609158 |
UniProt ID | Q5JPE7 |
◆ Recombinant Proteins | ||
NOMO2-5984H | Recombinant Human NOMO2 Protein, GST-tagged | +Inquiry |
NOMO2-1162H | Recombinant Human NOMO2 Protein, MYC/DDK-tagged | +Inquiry |
NOMO2-1331H | Recombinant Human NOMO2, GST-tagged | +Inquiry |
NOMO2-3878H | Recombinant Human NOMO2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NOMO2-3404H | Recombinant Human NOMO2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOMO2 Products
Required fields are marked with *
My Review for All NOMO2 Products
Required fields are marked with *
0
Inquiry Basket