Recombinant Human NOV Protein, GST-tagged

Cat.No. : NOV-6000H
Product Overview : Human NOV full-length ORF ( AAH15028, 1 a.a. - 357 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development. [provided by RefSeq
Molecular Mass : 65.01 kDa
AA Sequence : MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDEGSGLYCDRSADPSKQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NOV nephroblastoma overexpressed [ Homo sapiens ]
Official Symbol NOV
Synonyms NOV; nephroblastoma overexpressed; nephroblastoma overexpressed gene; protein NOV homolog; CCN3; IGFBP9; CCN family member 3; IGF-binding protein 9; insulin-like growth factor-binding protein 9; nephroblastoma-overexpressed gene protein homolog; NOVh; IBP-9; IGFBP-9;
Gene ID 4856
mRNA Refseq NM_002514
Protein Refseq NP_002505
MIM 164958
UniProt ID P48745

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NOV Products

Required fields are marked with *

My Review for All NOV Products

Required fields are marked with *

0

Inquiry Basket

cartIcon