Recombinant Human NPHS1

Cat.No. : NPHS1-29301TH
Product Overview : Recombinant fragment corresponding to amino acids 33-122 of Human Nephrin with an N terminal proprietary tag: Predicted MWt 35.53 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : This gene encodes a member of the immunoglobulin family of cell adhesion molecules that functions in the glomerular filtration barrier in the kidney. The gene is primarily expressed in renal tissues, and the protein is a type-1 transmembrane protein found at the slit diaphragm of glomerular podocytes. The slit diaphragm is thought to function as an ultrafilter to exclude albumin and other plasma macromolecules in the formation of urine. Mutations in this gene result in Finnish-type congenital nephrosis 1, characterized by severe proteinuria and loss of the slit diaphragm and foot processes.
Molecular Weight : 35.530kDa inclusive of tags
Tissue specificity : Specifically expressed in podocytes of kidney glomeruli.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPEL
Sequence Similarities : Belongs to the immunoglobulin superfamily.Contains 1 fibronectin type-III domain.Contains 8 Ig-like C2-type (immunoglobulin-like) domains.
Gene Name NPHS1 nephrosis 1, congenital, Finnish type (nephrin) [ Homo sapiens ]
Official Symbol NPHS1
Synonyms NPHS1; nephrosis 1, congenital, Finnish type (nephrin); nephrin; CNF; NPHN;
Gene ID 4868
mRNA Refseq NM_004646
Protein Refseq NP_004637
MIM 602716
Uniprot ID O60500
Chromosome Location 19q12-q13.1
Pathway Cell-Cell communication, organism-specific biosystem; Nephrin interactions, organism-specific biosystem; Nephrin/Neph1 signaling in the kidney podocyte, organism-specific biosystem;
Function alpha-actinin binding; protein binding; protein domain specific binding; spectrin binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPHS1 Products

Required fields are marked with *

My Review for All NPHS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon