Recombinant Human NPLOC4 Protein, GST-tagged
| Cat.No. : | NPLOC4-6035H |
| Product Overview : | Human NPL4 partial ORF ( NP_060391, 1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | NPLOC4 (NPL4 Homolog, Ubiquitin Recognition Factor) is a Protein Coding gene. Diseases associated with NPLOC4 include Dementia, Frontotemporal. Among its related pathways are Protein processing in endoplasmic reticulum and Translesion synthesis by Y family DNA polymerases bypasses lesions on DNA template. GO annotations related to this gene include ubiquitin protein ligase binding and ubiquitin binding. |
| Molecular Mass : | 37.73 kDa |
| AA Sequence : | MAESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSNKSLNLLKIKHGDLLFLFPSSLAGPSSEMETSVPPGFKVFGAPNVVEDE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NPLOC4 nuclear protein localization 4 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | NPLOC4 |
| Synonyms | NPLOC4; nuclear protein localization 4 homolog (S. cerevisiae); nuclear protein localization protein 4 homolog; FLJ20657; KIAA1499; NPL4; FLJ23742; |
| Gene ID | 55666 |
| mRNA Refseq | NM_017921 |
| Protein Refseq | NP_060391 |
| MIM | 606590 |
| UniProt ID | Q8TAT6 |
| ◆ Recombinant Proteins | ||
| NPLOC4-1349HFL | Recombinant Full Length Human NPLOC4 Protein, Flag-tagged | +Inquiry |
| NPLOC4-6035H | Recombinant Human NPLOC4 Protein, GST-tagged | +Inquiry |
| NPLOC4-6164M | Recombinant Mouse NPLOC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NPLOC4-1345H | Recombinant Human NPLOC4, His-tagged | +Inquiry |
| NPLOC4-10825M | Recombinant Mouse NPLOC4 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NPLOC4-3740HCL | Recombinant Human NPLOC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPLOC4 Products
Required fields are marked with *
My Review for All NPLOC4 Products
Required fields are marked with *
