Recombinant Human NPLOC4 Protein, GST-tagged

Cat.No. : NPLOC4-6035H
Product Overview : Human NPL4 partial ORF ( NP_060391, 1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : NPLOC4 (NPL4 Homolog, Ubiquitin Recognition Factor) is a Protein Coding gene. Diseases associated with NPLOC4 include Dementia, Frontotemporal. Among its related pathways are Protein processing in endoplasmic reticulum and Translesion synthesis by Y family DNA polymerases bypasses lesions on DNA template. GO annotations related to this gene include ubiquitin protein ligase binding and ubiquitin binding.
Molecular Mass : 37.73 kDa
AA Sequence : MAESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSNKSLNLLKIKHGDLLFLFPSSLAGPSSEMETSVPPGFKVFGAPNVVEDE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NPLOC4 nuclear protein localization 4 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol NPLOC4
Synonyms NPLOC4; nuclear protein localization 4 homolog (S. cerevisiae); nuclear protein localization protein 4 homolog; FLJ20657; KIAA1499; NPL4; FLJ23742;
Gene ID 55666
mRNA Refseq NM_017921
Protein Refseq NP_060391
MIM 606590
UniProt ID Q8TAT6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPLOC4 Products

Required fields are marked with *

My Review for All NPLOC4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon