Recombinant Human NPLOC4 Protein, GST-tagged
Cat.No. : | NPLOC4-6035H |
Product Overview : | Human NPL4 partial ORF ( NP_060391, 1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | NPLOC4 (NPL4 Homolog, Ubiquitin Recognition Factor) is a Protein Coding gene. Diseases associated with NPLOC4 include Dementia, Frontotemporal. Among its related pathways are Protein processing in endoplasmic reticulum and Translesion synthesis by Y family DNA polymerases bypasses lesions on DNA template. GO annotations related to this gene include ubiquitin protein ligase binding and ubiquitin binding. |
Molecular Mass : | 37.73 kDa |
AA Sequence : | MAESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSNKSLNLLKIKHGDLLFLFPSSLAGPSSEMETSVPPGFKVFGAPNVVEDE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NPLOC4 nuclear protein localization 4 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | NPLOC4 |
Synonyms | NPLOC4; nuclear protein localization 4 homolog (S. cerevisiae); nuclear protein localization protein 4 homolog; FLJ20657; KIAA1499; NPL4; FLJ23742; |
Gene ID | 55666 |
mRNA Refseq | NM_017921 |
Protein Refseq | NP_060391 |
MIM | 606590 |
UniProt ID | Q8TAT6 |
◆ Recombinant Proteins | ||
NPLOC4-6035H | Recombinant Human NPLOC4 Protein, GST-tagged | +Inquiry |
NPLOC4-10191Z | Recombinant Zebrafish NPLOC4 | +Inquiry |
NPLOC4-1349HFL | Recombinant Full Length Human NPLOC4 Protein, Flag-tagged | +Inquiry |
Nploc4-4473M | Recombinant Mouse Nploc4 Protein, Myc/DDK-tagged | +Inquiry |
NPLOC4-1345H | Recombinant Human NPLOC4, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPLOC4-3740HCL | Recombinant Human NPLOC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPLOC4 Products
Required fields are marked with *
My Review for All NPLOC4 Products
Required fields are marked with *
0
Inquiry Basket