Recombinant Human NPM1, GST-tagged
| Cat.No. : | NPM1-1417H |
| Product Overview : | Recombinant full-length human NPM1( AAH02398.1, 1 a.a. - 295 a.a.) protein was expressed with a GST tag. MW = 58.450001 kDa (528 aa). |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Tag : | GST |
| Description : | NPM1 is associated with nucleolar ribonucleoprotein structures and bind single-stranded nucleic acids. It may be involved in the assembly and/or transport of ribosome. Its regulation through SUMOylation (by SENP3 and SENP5) is another facet of the proteins"s regulation and cellular functions. It is located in nucleolus, but it can be translocated to the nucleoplasm in case of serum starvation or treatment with anticancer drugs. The protein is phosphorylated. |
| Protein Sequence : | MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL |
| Applications : | Enzyme-linked immunoabsorbent assay,Western Blot (Recombinant protein),Antibody Production,Protein Array. |
| Quality Control Testing : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. Best use within three months from the date of receipt of this protein. |
| Gene Name | NPM1 nucleophosmin (nucleolar phosphoprotein B23, numatrin) [ Homo sapiens ] |
| Synonyms | NPM1; nucleophosmin (nucleolar phosphoprotein B23, numatrin); B23; NPM; MGC104254; nucleophosmin 1; numatrin; nucleophosmin/nucleoplasmin family, member 1; Nucleolar protein NO38;Nucleolar phosphoprotein B23 |
| Gene ID | 4869 |
| mRNA Refseq | NM_001037738 |
| Protein Refseq | NP_001032827 |
| MIM | 164040 |
| UniProt ID | P06748 |
| Chromosome Location | 5q35 |
| Function | NF-kappaB binding; Tat protein binding; histone binding; protein heterodimerization activity; protein homodimerization activity; rRNA binding; ribosomal large subunit binding; ribosomal small subunit binding; transcription coactivator activity; unfolded protein binding |
| ◆ Recombinant Proteins | ||
| Npm1-4474M | Recombinant Mouse Npm1 Protein, Myc/DDK-tagged | +Inquiry |
| NPM1-2572H | Recombinant Human NPM1 protein(21-130 aa), C-His-tagged | +Inquiry |
| NPM1-6799H | Recombinant Human Nucleophosmin (nucleolar phosphoprotein B23, numatrin), His-tagged | +Inquiry |
| NPM1-231H | Recombinant Human NPM1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NPM1-6037H | Recombinant Human NPM1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NPM1-3737HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
| NPM1-3738HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
| NPM1-3739HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPM1 Products
Required fields are marked with *
My Review for All NPM1 Products
Required fields are marked with *
