Recombinant Human NPM1, GST-tagged

Cat.No. : NPM1-1417H
Product Overview : Recombinant full-length human NPM1( AAH02398.1, 1 a.a. - 295 a.a.) protein was expressed with a GST tag. MW = 58.450001 kDa (528 aa).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : GST
Description : NPM1 is associated with nucleolar ribonucleoprotein structures and bind single-stranded nucleic acids. It may be involved in the assembly and/or transport of ribosome. Its regulation through SUMOylation (by SENP3 and SENP5) is another facet of the proteins"s regulation and cellular functions. It is located in nucleolus, but it can be translocated to the nucleoplasm in case of serum starvation or treatment with anticancer drugs. The protein is phosphorylated.
Protein Sequence : MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Applications : Enzyme-linked immunoabsorbent assay,Western Blot (Recombinant protein),Antibody Production,Protein Array.
Quality Control Testing : 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing. Best use within three months from the date of receipt of this protein.
Gene Name NPM1 nucleophosmin (nucleolar phosphoprotein B23, numatrin) [ Homo sapiens ]
Synonyms NPM1; nucleophosmin (nucleolar phosphoprotein B23, numatrin); B23; NPM; MGC104254; nucleophosmin 1; numatrin; nucleophosmin/nucleoplasmin family, member 1; Nucleolar protein NO38;Nucleolar phosphoprotein B23
Gene ID 4869
mRNA Refseq NM_001037738
Protein Refseq NP_001032827
MIM 164040
UniProt ID P06748
Chromosome Location 5q35
Function NF-kappaB binding; Tat protein binding; histone binding; protein heterodimerization activity; protein homodimerization activity; rRNA binding; ribosomal large subunit binding; ribosomal small subunit binding; transcription coactivator activity; unfolded protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPM1 Products

Required fields are marked with *

My Review for All NPM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon