Recombinant Human NPPA Protein, GST-tagged
Cat.No. : | NPPA-6041H |
Product Overview : | Human NPPA full-length ORF ( AAH05893, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the natriuretic peptide family. Natriuretic peptides are implicated in the control of extracellular fluid volume and electrolyte homeostasis. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. Mutations in this gene have been associated with atrial fibrillation familial type 6. [provided by RefSeq |
Molecular Mass : | 42.57 kDa |
AA Sequence : | MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDGIGAQSGLGCNSFRYRR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NPPA natriuretic peptide A [ Homo sapiens ] |
Official Symbol | NPPA |
Synonyms | NPPA; natriuretic peptide A; ANP, natriuretic peptide precursor A , PND; natriuretic peptides A; atriopeptin; cardionatrin; prepronatriodilatin; natriuretic peptide precursor A; ANF; ANP; PND; ATFB6; CDD-ANF; |
Gene ID | 4878 |
mRNA Refseq | NM_006172 |
Protein Refseq | NP_006163 |
MIM | 108780 |
UniProt ID | P01160 |
◆ Recombinant Proteins | ||
NPPA-27326TH | Recombinant Human NPPA | +Inquiry |
NPPA-6641HF | Recombinant Full Length Human NPPA Protein, GST-tagged | +Inquiry |
Nppa-260M | Recombinant Mouse Nppa Protein, His/GST-tagged | +Inquiry |
NPPA-2689H | Recombinant Human NPPA protein, His & GST-tagged | +Inquiry |
NPPA-1850H | Recombinant Human NPPA Protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPPA-3735HCL | Recombinant Human NPPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPPA Products
Required fields are marked with *
My Review for All NPPA Products
Required fields are marked with *