Recombinant Human NQO1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NQO1-4163H
Product Overview : NQO1 MS Standard C13 and N15-labeled recombinant protein (NP_000894) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. This FAD-binding protein forms homodimers and reduces quinones to hydroquinones. This protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Molecular Mass : 30.9 kDa
AA Sequence : MVGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NQO1 NAD(P)H quinone dehydrogenase 1 [ Homo sapiens (human) ]
Official Symbol NQO1
Synonyms NQO1; NAD(P)H dehydrogenase, quinone 1; DIA4, diaphorase (NADH/NADPH) (cytochrome b 5 reductase), NMOR1; NAD(P)H dehydrogenase [quinone] 1; DHQU; DTD; QR1; azoreductase; diaphorase-4; DT-diaphorase; dioxin-inducible 1; menadione reductase; quinone reductase 1; phylloquinone reductase; NAD(P)H:quinone oxireductase; NAD(P)H:quinone oxidoreductase 1; NAD(P)H:menadione oxidoreductase 1; NAD(P)H:Quinone acceptor oxidoreductase type 1; diaphorase (NADH/NADPH) (cytochrome b-5 reductase); DIA4; NMOR1; NMORI;
Gene ID 1728
mRNA Refseq NM_000903
Protein Refseq NP_000894
MIM 125860
UniProt ID P15559

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NQO1 Products

Required fields are marked with *

My Review for All NQO1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon