Recombinant Human NQO1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NQO1-4163H |
Product Overview : | NQO1 MS Standard C13 and N15-labeled recombinant protein (NP_000894) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. This FAD-binding protein forms homodimers and reduces quinones to hydroquinones. This protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Molecular Mass : | 30.9 kDa |
AA Sequence : | MVGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NQO1 NAD(P)H quinone dehydrogenase 1 [ Homo sapiens (human) ] |
Official Symbol | NQO1 |
Synonyms | NQO1; NAD(P)H dehydrogenase, quinone 1; DIA4, diaphorase (NADH/NADPH) (cytochrome b 5 reductase), NMOR1; NAD(P)H dehydrogenase [quinone] 1; DHQU; DTD; QR1; azoreductase; diaphorase-4; DT-diaphorase; dioxin-inducible 1; menadione reductase; quinone reductase 1; phylloquinone reductase; NAD(P)H:quinone oxireductase; NAD(P)H:quinone oxidoreductase 1; NAD(P)H:menadione oxidoreductase 1; NAD(P)H:Quinone acceptor oxidoreductase type 1; diaphorase (NADH/NADPH) (cytochrome b-5 reductase); DIA4; NMOR1; NMORI; |
Gene ID | 1728 |
mRNA Refseq | NM_000903 |
Protein Refseq | NP_000894 |
MIM | 125860 |
UniProt ID | P15559 |
◆ Recombinant Proteins | ||
Nqo1-722R | Recombinant Rat Nqo1 | +Inquiry |
NQO1-136H | Recombinant Human NQO1 Protein | +Inquiry |
NQO1-29158TH | Recombinant Human NQO1, His-tagged | +Inquiry |
NQO1-1607HFL | Recombinant Full Length Human NQO1 Protein, C-Flag-tagged | +Inquiry |
NQO1-1352H | Recombinant Human NQO1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NQO1-3725HCL | Recombinant Human NQO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NQO1 Products
Required fields are marked with *
My Review for All NQO1 Products
Required fields are marked with *
0
Inquiry Basket