Recombinant Human NR4A1 protein, His-tagged
| Cat.No. : | NR4A1-3287H |
| Product Overview : | Recombinant Human NR4A1 protein(299-598 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 31, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 299-598 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | AKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | NR4A1 nuclear receptor subfamily 4, group A, member 1 [ Homo sapiens ] |
| Official Symbol | NR4A1 |
| Synonyms | NR4A1; nuclear receptor subfamily 4, group A, member 1; GFRP1, HMR; nuclear receptor subfamily 4 group A member 1; N10; NAK 1; NGFIB; NUR77; TR3; ST-59; hormone receptor; TR3 orphan receptor; steroid receptor TR3; testicular receptor 3; early response protein NAK1; orphan nuclear receptor HMR; orphan nuclear receptor TR3; nuclear hormone receptor NUR/77; growth factor-inducible nuclear protein N10; nerve growth factor IB nuclear receptor variant 1; HMR; NP10; GFRP1; NAK-1; MGC9485; |
| Gene ID | 3164 |
| mRNA Refseq | NM_001202233 |
| Protein Refseq | NP_001189162 |
| MIM | 139139 |
| UniProt ID | P22736 |
| ◆ Recombinant Proteins | ||
| NR4A1-6093H | Recombinant Human NR4A1 Protein, GST-tagged | +Inquiry |
| NR4A1-4396H | Recombinant Human NR4A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NR4A1-1360H | Recombinant Human NR4A1, GST-tagged | +Inquiry |
| NR4A1-6744HF | Recombinant Full Length Human NR4A1 Protein, GST-tagged | +Inquiry |
| Nr4a1-1855R | Recombinant Rat Nr4a1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NR4A1-1219HCL | Recombinant Human NR4A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NR4A1 Products
Required fields are marked with *
My Review for All NR4A1 Products
Required fields are marked with *



