Recombinant Full Length Human OLIG2 Protein, C-Flag-tagged
Cat.No. : | OLIG2-1769HFL |
Product Overview : | Recombinant Full Length Human OLIG2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 32.2 kDa |
AA Sequence : | MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKL GGSGFKXSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHG PSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPAATAHPAAAAH AAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSG ASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSLPRLTSDAK myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | OLIG2 oligodendrocyte transcription factor 2 [ Homo sapiens (human) ] |
Official Symbol | OLIG2 |
Synonyms | BHLHB1; OLIGO2; RACK17; PRKCBP2; bHLHe19 |
Gene ID | 10215 |
mRNA Refseq | NM_005806.4 |
Protein Refseq | NP_005797 |
MIM | 606386 |
UniProt ID | Q13516 |
◆ Recombinant Proteins | ||
Olig2-4590M | Recombinant Mouse Olig2 Protein, Myc/DDK-tagged | +Inquiry |
OLIG2-4438H | Recombinant Human OLIG2 protein, His-SUMO-tagged | +Inquiry |
OLIG2-38H | Recombinant Human OLIG2, GST-tagged | +Inquiry |
OLIG2-3842H | Recombinant Human OLIG2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
OLIG2-28318TH | Active Recombinant Human OLIG2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OLIG2-1248HCL | Recombinant Human OLIG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OLIG2 Products
Required fields are marked with *
My Review for All OLIG2 Products
Required fields are marked with *
0
Inquiry Basket