Recombinant Human P2RX4 protein, GST-tagged
Cat.No. : | P2RX4-301584H |
Product Overview : | Recombinant Human P2RX4 (57-341 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Thr57-Ser341 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization |
AA Sequence : | TDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHGFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | P2RX4 purinergic receptor P2X, ligand-gated ion channel, 4 [ Homo sapiens ] |
Official Symbol | P2RX4 |
Synonyms | P2RX4; purinergic receptor P2X, ligand-gated ion channel, 4; P2X purinoceptor 4; P2X4; ATP receptor; purinoceptor P2X4; P2X receptor, subunit 4; purinergic receptor P2X4; ATP-gated cation channel protein; P2X4R; |
Gene ID | 5025 |
mRNA Refseq | NM_001256796 |
Protein Refseq | NP_001243725 |
MIM | 600846 |
UniProt ID | Q99571 |
◆ Recombinant Proteins | ||
P2RX4-2736M | Recombinant Mouse P2RX4 Protein (55-338 aa), His-SUMO-tagged | +Inquiry |
P2RX4-3802H | Recombinant Human P2RX4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
P2RX4-301584H | Recombinant Human P2RX4 protein, GST-tagged | +Inquiry |
P2RX4-3891R | Recombinant Rat P2RX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
P2RX4-5864C | Recombinant Chicken P2RX4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
P2RX4-3499HCL | Recombinant Human P2RX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All P2RX4 Products
Required fields are marked with *
My Review for All P2RX4 Products
Required fields are marked with *