Recombinant Human PAPSS2, His-tagged
Cat.No. : | PAPSS2-32H |
Product Overview : | Recombinant Human Acyl-Protein Thioesterase 1/APT-1 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Asp230) of Human APT-1 fused with a His tag at the N-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-230 a.a. |
Description : | Acyl-Protein Thioesterase 1 (APT-1) is lysophospholipase that belongs to the AB hydrolase 2 family. APT-1 performs on biological membranes to regulate the multifunctional lysophospholipids. It hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS; in addition, it also has depalmitoylating activity and low lysophospholipase activity. |
Form : | Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 100mM NaCl, 1mM DTT, 10% Glycerol, pH 8.0 |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIR SSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPS NRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDP LVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Store at Please minimize freeze-thaw cycles. |
Gene Name | PAPSS2 3-phosphoadenosine 5-phosphosulfate synthase 2 [ Homo sapiens ] |
Official Symbol | PAPSS2 |
Synonyms | PAPSS2; 3-phosphoadenosine 5-phosphosulfate synthase 2; bifunctional 3-phosphoadenosine 5-phosphosulfate synthase 2; ATPSK2; SK 2; PAPSS 2; PAPS synthase 2; PAPS synthetase 2; ATP sulfurylase/APS kinase 2; ATP sulfurylase/adenosine 5-phosphosulfate kinase; 3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2; bifunctional 3-phosphoadenosine 5-phosphosulfate synthethase 2; SK2; |
Gene ID | 9060 |
mRNA Refseq | NM_001015880 |
Protein Refseq | NP_001015880 |
MIM | 603005 |
UniProt ID | O95340 |
Chromosome Location | 10q24 |
Pathway | Biological oxidations, organism-specific biosystem; Cytosolic sulfonation of small molecules, organism-specific biosystem; Formation of PAPS, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Phase II conjugation, organism-specific biosystem; Purine metabolism, organism-specific biosystem; |
Function | ATP binding; adenylylsulfate kinase activity; nucleotide binding; nucleotidyltransferase activity; sulfate adenylyltransferase (ATP) activity; |
◆ Recombinant Proteins | ||
PAPSS2-3299R | Recombinant Rhesus monkey PAPSS2 Protein, His-tagged | +Inquiry |
PAPSS2-3117R | Recombinant Rhesus Macaque PAPSS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PAPSS2-1524H | Recombinant Human PAPSS2 protein, His-tagged | +Inquiry |
PAPSS2-6743H | Recombinant Human PAPSS2 protein, GST-tagged | +Inquiry |
PAPSS2-32H | Recombinant Human PAPSS2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAPSS2-3440HCL | Recombinant Human PAPSS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAPSS2 Products
Required fields are marked with *
My Review for All PAPSS2 Products
Required fields are marked with *
0
Inquiry Basket