Recombinant Human PAX6 protein, His-tagged

Cat.No. : PAX6-1884H
Product Overview : Recombinant Human PAX6 protein(126-229 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 126-229 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : VLRNLASEKQQMGADGMYDKLRMLNGQTGSWGTRPGWYPGTSVPGQPTQDGCQQQEGGGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEF
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name PAX6 paired box 6 [ Homo sapiens ]
Official Symbol PAX6
Synonyms PAX6; paired box 6; AN2, paired box gene 6 (aniridia, keratitis); paired box protein Pax-6; AN; aniridia; keratitis; D11S812E; WAGR; oculorhombin; aniridia type II protein; paired box homeotic gene-6; AN2; MGDA; MGC17209;
Gene ID 5080
mRNA Refseq NM_000280
Protein Refseq NP_000271
MIM 607108
UniProt ID P26367

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PAX6 Products

Required fields are marked with *

My Review for All PAX6 Products

Required fields are marked with *

0
cart-icon
0
compare icon