Recombinant Human PCSK1 protein, His-tagged
Cat.No. : | PCSK1-6844H |
Product Overview : | Recombinant Human PCSK1 protein(580-753 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 580-753 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | NEGRIVNWKLILHGTSSQPEHMKQPRVYTSYNTVQNDRRGVEKMVDPGEEQPTQENPKENTLVSKSPSSSSVGGRRDELEEGAPSEAMLRLLQSAFSKNSPPKQSPKKSPTAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTKPYKHRDDRLLQALVDILNEEN |
Gene Name | PCSK1 proprotein convertase subtilisin/kexin type 1 [ Homo sapiens ] |
Official Symbol | PCSK1 |
Synonyms | PCSK1; proprotein convertase subtilisin/kexin type 1; NEC1; neuroendocrine convertase 1; PC1; PC3; prohormone convertase 1; prohormone convertase 3; proprotein convertase 1; SPC3; NEC 1; BMIQ12; |
Gene ID | 5122 |
mRNA Refseq | NM_000439 |
Protein Refseq | NP_000430 |
MIM | 162150 |
UniProt ID | P29120 |
◆ Recombinant Proteins | ||
PCSK1-2711H | Recombinant Human PCSK1 protein(641-730 aa), C-His-tagged | +Inquiry |
PCSK1-892H | Recombinant Human PCSK1 protein, His-tagged | +Inquiry |
PCSK1-6845H | Recombinant Human PCSK1 protein, His-tagged | +Inquiry |
PCSK1-12513M | Recombinant Mouse PCSK1 Protein | +Inquiry |
PCSK1-7222Z | Recombinant Zebrafish PCSK1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCSK1-2249HCL | Recombinant Human PCSK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCSK1 Products
Required fields are marked with *
My Review for All PCSK1 Products
Required fields are marked with *
0
Inquiry Basket