Recombinant Human PDE1C protein, GST-tagged

Cat.No. : PDE1C-7844H
Product Overview : Recombinant Human PDE1C protein(284-634 aa), fused with N-terminal GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 284-634 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : RSDPAILYNDRSVLENHHLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKSTMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKRSGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKARMAAEEQQKEMEAKSQAEEGASGKAEKKTSGETKNQVNGTRANKSDNPRGKNSKAEKSSGEQQQNGDFKDGKNKTDKKDHSNIGNDSKKTDDSQE
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name PDE1C phosphodiesterase 1C, calmodulin-dependent 70kDa [ Homo sapiens ]
Official Symbol PDE1C
Synonyms PDE1C; phosphodiesterase 1C, calmodulin-dependent 70kDa; phosphodiesterase 1C, calmodulin dependent (70kD); calcium/calmodulin-dependent 3,5-cyclic nucleotide phosphodiesterase 1C; Hcam3; hCam-3; cam-PDE 1C; Human 3,5 cyclic nucleotide phosphodiesterase (HSPDE1C1A);
Gene ID 5137
mRNA Refseq NM_001191056
Protein Refseq NP_001177985
MIM 602987
UniProt ID Q14123

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDE1C Products

Required fields are marked with *

My Review for All PDE1C Products

Required fields are marked with *

0
cart-icon