Recombinant Human PDGFD protein, His-tagged
| Cat.No. : | PDGFD-3231H |
| Product Overview : | Recombinant Human PDGFD protein(19-265 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 19-265 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | RDTSATPQSASIKALRNANLRRDDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDISETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASETNWESVTSSISGVSYNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMYLDTPRYRGRSYHDRKSKVDLDRLNDDAKRYS |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PDGFD platelet derived growth factor D [ Homo sapiens ] |
| Official Symbol | PDGFD |
| Synonyms | PDGFD; platelet derived growth factor D; platelet-derived growth factor D; IEGF; MSTP036; SCDGF B; spinal cord derived growth factor B; PDGF-D; iris-expressed growth factor; spinal cord-derived growth factor B; spinal cord-derived growth factor-B; SCDGFB; SCDGF-B; MGC26867; |
| Gene ID | 80310 |
| mRNA Refseq | NM_025208 |
| Protein Refseq | NP_079484 |
| MIM | 609673 |
| UniProt ID | Q9GZP0 |
| ◆ Recombinant Proteins | ||
| PDGFD-7140H | Recombinant Human Platelet Derived Growth Factor D, His-tagged | +Inquiry |
| PDGFD-209P | Active Recombinant Human PDGFDD Protein | +Inquiry |
| Pdgfd-390M | Recombinant Mouse Pdgfd protein, His/SUMO-tagged | +Inquiry |
| PDGFD-1258M | Recombinant Mouse PDGFD protein, His-tagged | +Inquiry |
| PDGFD-3999R | Recombinant Rat PDGFD Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDGFD-3335HCL | Recombinant Human PDGFD 293 Cell Lysate | +Inquiry |
| PDGFD-3336HCL | Recombinant Human PDGFD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFD Products
Required fields are marked with *
My Review for All PDGFD Products
Required fields are marked with *



