Recombinant Human PDGFD protein, His-tagged
Cat.No. : | PDGFD-3231H |
Product Overview : | Recombinant Human PDGFD protein(19-265 aa), fused to His tag, was expressed in E. coli. |
Availability | August 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-265 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RDTSATPQSASIKALRNANLRRDDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDISETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASETNWESVTSSISGVSYNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMYLDTPRYRGRSYHDRKSKVDLDRLNDDAKRYS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PDGFD platelet derived growth factor D [ Homo sapiens ] |
Official Symbol | PDGFD |
Synonyms | PDGFD; platelet derived growth factor D; platelet-derived growth factor D; IEGF; MSTP036; SCDGF B; spinal cord derived growth factor B; PDGF-D; iris-expressed growth factor; spinal cord-derived growth factor B; spinal cord-derived growth factor-B; SCDGFB; SCDGF-B; MGC26867; |
Gene ID | 80310 |
mRNA Refseq | NM_025208 |
Protein Refseq | NP_079484 |
MIM | 609673 |
UniProt ID | Q9GZP0 |
◆ Recombinant Proteins | ||
PDGFD-7140H | Recombinant Human Platelet Derived Growth Factor D, His-tagged | +Inquiry |
Pdgfd-390M | Recombinant Mouse Pdgfd protein, His/SUMO-tagged | +Inquiry |
PDGFD-3231H | Recombinant Human PDGFD protein, His-tagged | +Inquiry |
PDGFD-211H | Active Recombinant Human PDGFD | +Inquiry |
PDGFD-209P | Active Recombinant Human PDGFDD Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFD-3335HCL | Recombinant Human PDGFD 293 Cell Lysate | +Inquiry |
PDGFD-3336HCL | Recombinant Human PDGFD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFD Products
Required fields are marked with *
My Review for All PDGFD Products
Required fields are marked with *