Recombinant Human PDXP protein, GST-tagged
Cat.No. : | PDXP-1884H |
Product Overview : | Recombinant Human PDXP protein(115-230 aa), fused to GST tag, was expressed in E. coli. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 115-230 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | GEGLRAELRAAGLRLAGDPSAGDGAAPRVRAVLVGYDEHFSFAKLREACAHLRDPECLLVATDRDPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSIDP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PDXP pyridoxal (pyridoxine, vitamin B6) phosphatase [ Homo sapiens ] |
Official Symbol | PDXP |
Synonyms | PDXP; pyridoxal (pyridoxine, vitamin B6) phosphatase; pyridoxal phosphate phosphatase; dJ37E16.5; FLJ32703; chronophin; PLP phosphatase; CIN; PLP; |
Gene ID | 57026 |
mRNA Refseq | NM_020315 |
Protein Refseq | NP_064711 |
MIM | 609246 |
UniProt ID | Q96GD0 |
◆ Recombinant Proteins | ||
PDXP-1884H | Recombinant Human PDXP protein, GST-tagged | +Inquiry |
PDXP-2762H | Recombinant Human PDXP, His-tagged | +Inquiry |
PDXP-2491M | Recombinant Mouse PDXP Protein (1-292 aa), His-tagged | +Inquiry |
PDXP-2078H | Recombinant Human PDXP Protein (1-296 aa), His-tagged | +Inquiry |
PDXP-30082TH | Recombinant Human PDXP, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDXP Products
Required fields are marked with *
My Review for All PDXP Products
Required fields are marked with *