Recombinant Human PFN1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PFN1-3109H
Product Overview : PFN1 MS Standard C13 and N15-labeled recombinant protein (NP_005013) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1.
Molecular Mass : 15.1 kDa
AA Sequence : MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PFN1 profilin 1 [ Homo sapiens (human) ]
Official Symbol PFN1
Synonyms PFN1; profilin 1; profilin-1; profilin I;
Gene ID 5216
mRNA Refseq NM_005022
Protein Refseq NP_005013
MIM 176610
UniProt ID P07737

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PFN1 Products

Required fields are marked with *

My Review for All PFN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon