Recombinant Human PFN1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PFN1-3109H
• Product Overview: PFN1 MS Standard C13 and N15-labeled recombinant protein (NP_005013) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1.
• Molecular Mass: 15.1 kDa
• AA Sequence: MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PFN1 profilin 1 [ Homo sapiens (human) ]
• Official Symbol: PFN1
• Synonyms: PFN1; profilin 1; profilin-1; profilin I
• Gene ID: 5216
• mRNA Refseq: NM_005022
• Protein Refseq: NP_005013
• MIM: 176610
• UniProt ID: P07737