Recombinant Human PGLYRP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PGLYRP1-1207H
Product Overview : PGLYRP1 MS Standard C13 and N15-labeled recombinant protein (NP_005082) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : PGLYRP1 (Peptidoglycan Recognition Protein 1) is a Protein Coding gene. Diseases associated with PGLYRP1 include Spherocytosis, Type 2 and Mite Infestation. Among its related pathways are Innate Immune System and Defensins. Gene Ontology (GO) annotations related to this gene include peptidoglycan binding and N-acetylmuramoyl-L-alanine amidase activity. An important paralog of this gene is PGLYRP3.
Molecular Mass : 21.7 kDa
AA Sequence : MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PGLYRP1 peptidoglycan recognition protein 1 [ Homo sapiens (human) ]
Official Symbol PGLYRP1
Synonyms PGLYRP1; peptidoglycan recognition protein 1; peptidoglycan recognition protein, PGLYRP, TNFSF3L; PGRP; PGRP S; PGRPS; TAG7; TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein); PGLYRP; PGRP-S; TNFSF3L; MGC126894; MGC126896;
Gene ID 8993
mRNA Refseq NM_005091
Protein Refseq NP_005082
MIM 604963
UniProt ID O75594

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PGLYRP1 Products

Required fields are marked with *

My Review for All PGLYRP1 Products

Required fields are marked with *

0
cart-icon