Recombinant Human PGLYRP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PGLYRP1-1207H |
Product Overview : | PGLYRP1 MS Standard C13 and N15-labeled recombinant protein (NP_005082) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | PGLYRP1 (Peptidoglycan Recognition Protein 1) is a Protein Coding gene. Diseases associated with PGLYRP1 include Spherocytosis, Type 2 and Mite Infestation. Among its related pathways are Innate Immune System and Defensins. Gene Ontology (GO) annotations related to this gene include peptidoglycan binding and N-acetylmuramoyl-L-alanine amidase activity. An important paralog of this gene is PGLYRP3. |
Molecular Mass : | 21.7 kDa |
AA Sequence : | MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PGLYRP1 peptidoglycan recognition protein 1 [ Homo sapiens (human) ] |
Official Symbol | PGLYRP1 |
Synonyms | PGLYRP1; peptidoglycan recognition protein 1; peptidoglycan recognition protein, PGLYRP, TNFSF3L; PGRP; PGRP S; PGRPS; TAG7; TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein); PGLYRP; PGRP-S; TNFSF3L; MGC126894; MGC126896; |
Gene ID | 8993 |
mRNA Refseq | NM_005091 |
Protein Refseq | NP_005082 |
MIM | 604963 |
UniProt ID | O75594 |
◆ Recombinant Proteins | ||
PGLYRP1-4068R | Recombinant Rat PGLYRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pglyrp1-571M | Recombinant Mouse PGLYRP1 protein(Met1-Glu182), His-tagged | +Inquiry |
PGLYRP1-06H | Active Recombinant Human PGLYRP1 Protein, His-tagged | +Inquiry |
PGLYRP1-732H | Recombinant Human PGLYRP1 Protein, his-tagged | +Inquiry |
Pglyrp1-1052M | Active Recombinant Mouse Pglyrp1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGLYRP1-1339HCL | Recombinant Human PGLYRP1 cell lysate | +Inquiry |
PGLYRP1-1873MCL | Recombinant Mouse PGLYRP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PGLYRP1 Products
Required fields are marked with *
My Review for All PGLYRP1 Products
Required fields are marked with *