Recombinant Human PIP5K1C protein, GST-tagged
Cat.No. : | PIP5K1C-5733H |
Product Overview : | Recombinant Human PIP5K1C protein(480-573 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 480-573 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MIPSEREEAQYDLRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSPSETSEQPRYRRRTQSSGQDGRPQEEPPAEEDLQ |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | PIP5K1C |
Synonyms | PIP5K1C; phosphatidylinositol-4-phosphate 5-kinase, type I, gamma; phosphatidylinositol-4-phosphate 5-kinase type-1 gamma; KIAA0589; LCCS3; PIP5Kgamma; PIP5K1-gamma; type I PIP kinase; diphosphoinositide kinase; ptdIns(4)P-5-kinase 1 gamma; Human homolog of mouse phosphatidylinositol-4-phosphate 5-kinase I-gamma; PIPKIg_v4; PIP5K-GAMMA; |
Gene ID | 23396 |
mRNA Refseq | NM_001195733 |
Protein Refseq | NP_001182662 |
MIM | 606102 |
UniProt ID | O60331 |
◆ Recombinant Proteins | ||
PIP5K1C-1083H | Recombinant Human phosphatidylinositol-4-phosphate 5-kinase, type I, GST-tagged | +Inquiry |
PIP5K1C-172H | Active Recombinant Human PIP5K1C protein, GST-tagged | +Inquiry |
PIP5K1C-12830M | Recombinant Mouse PIP5K1C Protein | +Inquiry |
PIP5K1C-5733H | Recombinant Human PIP5K1C protein, GST-tagged | +Inquiry |
PIP5K1C-4293HF | Active Recombinant Full Length Human PIP5K1C Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIP5K1C-3172HCL | Recombinant Human PIP5K1C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIP5K1C Products
Required fields are marked with *
My Review for All PIP5K1C Products
Required fields are marked with *
0
Inquiry Basket