Recombinant Human PIP5K1C protein, His-tagged
| Cat.No. : | PIP5K1C-3794H |
| Product Overview : | Recombinant Human PIP5K1C protein(480 - 573 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 480 - 573 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MIPSEREEAQYDLRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSPSETSEQPRYRRRTQSSGQDGRPQEEPPAEEDLQ |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PIP5K1C phosphatidylinositol-4-phosphate 5-kinase, type I, gamma [ Homo sapiens ] |
| Official Symbol | PIP5K1C |
| Synonyms | PIP5K1C; phosphatidylinositol-4-phosphate 5-kinase, type I, gamma; phosphatidylinositol-4-phosphate 5-kinase type-1 gamma; KIAA0589; LCCS3; PIP5Kgamma; PIP5K1-gamma; type I PIP kinase; diphosphoinositide kinase; ptdIns(4)P-5-kinase 1 gamma; Human homolog of mouse phosphatidylinositol-4-phosphate 5-kinase I-gamma; PIPKIg_v4; PIP5K-GAMMA; |
| Gene ID | 23396 |
| mRNA Refseq | NM_001195733 |
| Protein Refseq | NP_001182662 |
| MIM | 606102 |
| UniProt ID | O60331 |
| ◆ Recombinant Proteins | ||
| PIP5K1C-148HFL | Active Recombinant Full Length Human PIP5K1C Protein, N-His-tagged | +Inquiry |
| PIP5K1C-3794H | Recombinant Human PIP5K1C protein, His-tagged | +Inquiry |
| PIP5K1C-12830M | Recombinant Mouse PIP5K1C Protein | +Inquiry |
| PIP5K1C-4293HF | Active Recombinant Full Length Human PIP5K1C Protein, GST-tagged | +Inquiry |
| PIP5K1C-5733H | Recombinant Human PIP5K1C protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PIP5K1C-3172HCL | Recombinant Human PIP5K1C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIP5K1C Products
Required fields are marked with *
My Review for All PIP5K1C Products
Required fields are marked with *



