Recombinant Human PIP5K1C protein, His-tagged

Cat.No. : PIP5K1C-3794H
Product Overview : Recombinant Human PIP5K1C protein(480 - 573 aa), fused to His tag, was expressed in E. coli.
Availability December 19, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 480 - 573 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MIPSEREEAQYDLRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSPSETSEQPRYRRRTQSSGQDGRPQEEPPAEEDLQ
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PIP5K1C phosphatidylinositol-4-phosphate 5-kinase, type I, gamma [ Homo sapiens ]
Official Symbol PIP5K1C
Synonyms PIP5K1C; phosphatidylinositol-4-phosphate 5-kinase, type I, gamma; phosphatidylinositol-4-phosphate 5-kinase type-1 gamma; KIAA0589; LCCS3; PIP5Kgamma; PIP5K1-gamma; type I PIP kinase; diphosphoinositide kinase; ptdIns(4)P-5-kinase 1 gamma; Human homolog of mouse phosphatidylinositol-4-phosphate 5-kinase I-gamma; PIPKIg_v4; PIP5K-GAMMA;
Gene ID 23396
mRNA Refseq NM_001195733
Protein Refseq NP_001182662
MIM 606102
UniProt ID O60331

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PIP5K1C Products

Required fields are marked with *

My Review for All PIP5K1C Products

Required fields are marked with *

0
cart-icon
0
compare icon