Recombinant Human PIP5K1C protein, His-tagged

• Cat.No.: PIP5K1C-3794H
• Product Overview: Recombinant Human PIP5K1C protein(480 - 573 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 480 - 573 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MIPSEREEAQYDLRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSPSETSEQPRYRRRTQSSGQDGRPQEEPPAEEDLQ
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PIP5K1C phosphatidylinositol-4-phosphate 5-kinase, type I, gamma [ Homo sapiens ]
• Official Symbol: PIP5K1C
• Synonyms: PIP5K1C; phosphatidylinositol-4-phosphate 5-kinase, type I, gamma; phosphatidylinositol-4-phosphate 5-kinase type-1 gamma; KIAA0589; LCCS3; PIP5Kgamma; PIP5K1-gamma; type I PIP kinase; diphosphoinositide kinase; ptdIns(4)P-5-kinase 1 gamma; Human homolog of mouse phosphatidylinositol-4-phosphate 5-kinase I-gamma; PIPKIg_v4; PIP5K-GAMMA
• Gene ID: 23396
• mRNA Refseq: NM_001195733
• Protein Refseq: NP_001182662
• MIM: 606102
• UniProt ID: O60331