Recombinant Human PISD protein, GST-tagged
| Cat.No. : | PISD-15H |
| Product Overview : | Recombinant Human PISD(1 a.a. - 409 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-409 a.a. |
| Description : | Phosphatidylserine decarboxylases (PSDs; EC 4.1.1.65) catalyze the formation of phosphatidylethanolamine (PE) by decarboxylation of phosphatidylserine (PS). Type I PSDs, such as PISD, are targeted to the inner mitochondrial membrane by an N-terminal targeting sequence. PISD also contains a conserved LGST motif that functions as an autocatalytic cleavage site where the proenzyme is split into mature alpha and beta subunits (Schuiki and Daum, 2009 [PubMed 19165886]). |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 71.39 kDa |
| AA Sequence : | MATSVGHRCLGLLHGVAPWRSSLHPCEITALSQSLQPLRKLPFRAFRTDARKIHTAPARTMFLLRPLPILLVTGG GYAGYRQYEKYRERELEKLGLEIPPKLAGHWEVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVN MKEAAVEDLHHYRNLSEFFRRKLKPQARPVCGLHSVISPSDGRILNFGQVKNCEVEQVKGVTYSLESFLGPRMCT EDLPFPPAASCDSFKNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKELFC HNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRHSKGSYNDFSFVTHTNREGVPMRKGEHLGEFN LGSTIVLIFEAPKDFNFQLKTGQKIRFGEALGSL |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | PISD phosphatidylserine decarboxylase [ Homo sapiens ] |
| Official Symbol | PISD |
| Synonyms | PISD; phosphatidylserine decarboxylase; phosphatidylserine decarboxylase proenzyme; dJ858B16.2; PSDC; PSD; PSSC; DJ858B16; DKFZp566G2246; |
| Gene ID | 23761 |
| mRNA Refseq | NM_014338 |
| Protein Refseq | NP_055153 |
| MIM | 612770 |
| UniProt ID | Q9UG56 |
| Chromosome Location | 22q12.2 |
| Pathway | FOXA1 transcription factor network, organism-specific biosystem; Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
| Function | lyase activity; phosphatidylserine decarboxylase activity; |
| ◆ Recombinant Proteins | ||
| PISD-17H | Recombinant Human PISD protein, His-tagged | +Inquiry |
| PISD-16H | Recombinant Human PISD protein, GST-tagged | +Inquiry |
| PISD-15H | Recombinant Human PISD protein, GST-tagged | +Inquiry |
| PISD-001H | Recombinant Human PISD Protein, His-tagged | +Inquiry |
| PISD-625HF | Recombinant Full Length Human PISD Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PISD Products
Required fields are marked with *
My Review for All PISD Products
Required fields are marked with *
