Recombinant Human PLCG1

Cat.No. : PLCG1-30735TH
Product Overview : Recombinant fragment corresponding to amino acids 1192-1291 of Human Phospholipase C gamma 1 with proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators. For example, when activated by SRC, the encoded protein causes the Ras guanine nucleotide exchange factor RasGRP1 to translocate to the Golgi, where it activates Ras. Also, this protein has been shown to be a major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
Sequence Similarities : Contains 1 C2 domain.Contains 1 EF-hand domain.Contains 2 PH domains.Contains 1 PI-PLC X-box domain.Contains 1 PI-PLC Y-box domain.Contains 2 SH2 domains.Contains 1 SH3 domain.
Gene Name PLCG1 phospholipase C, gamma 1 [ Homo sapiens ]
Official Symbol PLCG1
Synonyms PLCG1; phospholipase C, gamma 1; phospholipase C, gamma 1 (formerly subtype 148) , PLC1; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1; NCKAP3; PLC II; PLC148; PLCgamma1;
Gene ID 5335
mRNA Refseq NM_002660
Protein Refseq NP_002651
MIM 172420
Uniprot ID P19174
Chromosome Location 20q12-q13.1
Pathway Adaptive Immune System, organism-specific biosystem; Axon guidance, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem;
Function calcium ion binding; hydrolase activity; phosphatidylinositol phospholipase C activity; phosphatidylinositol phospholipase C activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLCG1 Products

Required fields are marked with *

My Review for All PLCG1 Products

Required fields are marked with *

0
cart-icon