Recombinant Human PLCG1
Cat.No. : | PLCG1-30735TH |
Product Overview : | Recombinant fragment corresponding to amino acids 1192-1291 of Human Phospholipase C gamma 1 with proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators. For example, when activated by SRC, the encoded protein causes the Ras guanine nucleotide exchange factor RasGRP1 to translocate to the Golgi, where it activates Ras. Also, this protein has been shown to be a major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL |
Sequence Similarities : | Contains 1 C2 domain.Contains 1 EF-hand domain.Contains 2 PH domains.Contains 1 PI-PLC X-box domain.Contains 1 PI-PLC Y-box domain.Contains 2 SH2 domains.Contains 1 SH3 domain. |
Gene Name | PLCG1 phospholipase C, gamma 1 [ Homo sapiens ] |
Official Symbol | PLCG1 |
Synonyms | PLCG1; phospholipase C, gamma 1; phospholipase C, gamma 1 (formerly subtype 148) , PLC1; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1; NCKAP3; PLC II; PLC148; PLCgamma1; |
Gene ID | 5335 |
mRNA Refseq | NM_002660 |
Protein Refseq | NP_002651 |
MIM | 172420 |
Uniprot ID | P19174 |
Chromosome Location | 20q12-q13.1 |
Pathway | Adaptive Immune System, organism-specific biosystem; Axon guidance, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; |
Function | calcium ion binding; hydrolase activity; phosphatidylinositol phospholipase C activity; phosphatidylinositol phospholipase C activity; protein binding; |
◆ Recombinant Proteins | ||
PLCG1-94HFL | Recombinant Full Length Human PLCG1 Protein, C-Flag-tagged | +Inquiry |
PLCG1-1703H | Recombinant Human PLCG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLCG1-30735TH | Recombinant Human PLCG1 | +Inquiry |
PLCG1-17H | Recombinant Human PLCG1, MYC/DDK-tagged | +Inquiry |
PLCG1-4505R | Recombinant Rat PLCG1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLCG1 Products
Required fields are marked with *
My Review for All PLCG1 Products
Required fields are marked with *
0
Inquiry Basket