Recombinant Human PLCG2 protein, GST-tagged

Cat.No. : PLCG2-7855H
Product Overview : Recombinant Human PLCG2 protein(826-928 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : GST
Protein Length : 826-928 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : DISTADFEELEKQIIEDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGYPPVEFATDRVEELFEWFQSIREITWKIDTKENNMKYWEKNQSIAI
Purity : 85%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name PLCG2 phospholipase C, gamma 2 (phosphatidylinositol-specific) [ Homo sapiens ]
Official Symbol PLCG2
Synonyms PLCG2; phospholipase C, gamma 2 (phosphatidylinositol-specific); 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; PLC-IV; PLC-gamma-2; phospholipase C-IV; phosphoinositide phospholipase C-gamma-2; FCAS3;
mRNA Refseq NM_002661
Protein Refseq NP_002652
MIM 600220
UniProt ID P16885
Gene ID 5336

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLCG2 Products

Required fields are marked with *

My Review for All PLCG2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon