Recombinant Human PLCG2 protein, His-tagged
| Cat.No. : | PLCG2-7856H |
| Product Overview : | Recombinant Human PLCG2 protein(826-928 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 826-928 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | DISTADFEELEKQIIEDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGYPPVEFATDRVEELFEWFQSIREITWKIDTKENNMKYWEKNQSIAI |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | PLCG2 phospholipase C, gamma 2 (phosphatidylinositol-specific) [ Homo sapiens ] |
| Official Symbol | PLCG2 |
| Synonyms | PLCG2; phospholipase C, gamma 2 (phosphatidylinositol-specific); 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; PLC-IV; PLC-gamma-2; phospholipase C-IV; phosphoinositide phospholipase C-gamma-2; FCAS3; |
| mRNA Refseq | NM_002661 |
| Protein Refseq | NP_002652 |
| MIM | 600220 |
| UniProt ID | P16885 |
| Gene ID | 5336 |
| ◆ Recombinant Proteins | ||
| PLCG2-618HFL | Recombinant Full Length Human PLCG2 Protein, C-Flag-tagged | +Inquiry |
| PLCG2-12925M | Recombinant Mouse PLCG2 Protein | +Inquiry |
| PLCG2-4166R | Recombinant Rat PLCG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PLCG2-1750H | Recombinant Human PLCG2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Plcg2-4918M | Recombinant Mouse Plcg2 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLCG2-3127HCL | Recombinant Human PLCG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLCG2 Products
Required fields are marked with *
My Review for All PLCG2 Products
Required fields are marked with *
