Recombinant Human PLCG2 protein, His-tagged
Cat.No. : | PLCG2-7856H |
Product Overview : | Recombinant Human PLCG2 protein(826-928 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 826-928 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | DISTADFEELEKQIIEDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGYPPVEFATDRVEELFEWFQSIREITWKIDTKENNMKYWEKNQSIAI |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | PLCG2 phospholipase C, gamma 2 (phosphatidylinositol-specific) [ Homo sapiens ] |
Official Symbol | PLCG2 |
Synonyms | PLCG2; phospholipase C, gamma 2 (phosphatidylinositol-specific); 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; PLC-IV; PLC-gamma-2; phospholipase C-IV; phosphoinositide phospholipase C-gamma-2; FCAS3; |
mRNA Refseq | NM_002661 |
Protein Refseq | NP_002652 |
MIM | 600220 |
UniProt ID | P16885 |
Gene ID | 5336 |
◆ Recombinant Proteins | ||
PLCG2-1750H | Recombinant Human PLCG2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Plcg2-4918M | Recombinant Mouse Plcg2 Protein, Myc/DDK-tagged | +Inquiry |
PLCG2-7856H | Recombinant Human PLCG2 protein, His-tagged | +Inquiry |
PLCG2-1018H | Recombinant Human PLCG2 protein, His & T7-tagged | +Inquiry |
PLCG2-12925M | Recombinant Mouse PLCG2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLCG2-3127HCL | Recombinant Human PLCG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLCG2 Products
Required fields are marked with *
My Review for All PLCG2 Products
Required fields are marked with *
0
Inquiry Basket