| Species : | Human | 
                                
                                    | Source : | Yeast | 
                                
                                    | Tag : | His | 
                                
                                    | Protein Length : | 986-1152 aa | 
                                
                                    | Description : | Coreceptor for SA3A, SA3C, SA3F and SA6D. Necessary for signaling by class 3 saphorins and subsequent rodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. Class 3 saphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific saphorins, and its Cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm. | 
                                
                                    | Form : | Tris-based buffer,50% glycerol | 
                                
                                    | Molecular Mass : | 20.3 kDa | 
                                
                                    | AA Sequence : | LNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQSPGSAPIIININRAQLTNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGGIERENGCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLNSTSFLYYPDPVL | 
                                
                                    | Purity : | > 90% as determined by SDS-PAGE. | 
                                
                                    | Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. | 
                                
                                    | Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. | 
                                
                                    | Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |