Recombinant Human PNPLA3 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | PNPLA3-091H |
Product Overview : | PNPLA3 MS Standard C13 and N15-labeled recombinant protein (NP_079501) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a triacylglycerol lipase that mediates triacylglycerol hydrolysis in adipocytes. The encoded protein, which appears to be membrane bound, may be involved in the balance of energy usage/storage in adipocytes. |
Molecular Mass : | 52.8 kDa |
AA Sequence : | MYDAERGWSLSFAGCGFLGFYHVGATRCLSEHAPHLLRDARMLFGASAGALHCVGVLSGIPLEQTLQVLSDLVRKARSRNIGIFHPSFNLSKFLRQGLGKCLPANVHQLISGKIGISLTRVSDGENVLVSDFRSKDEVVDALVCSCFMPFYSGLIPPSFRGVRYVDGGVSDNVPFIDAKTTITVSPFYGEYDICPKVKSTNFLHVDITKLSLRLCTGNLYLLSRAFVPPDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYMSKICNLLPIRIMSYVMLPCTLPVESAIAIVQRLVTWLPDMPDDVLWLQWVTSQVFTRVLMCLLPASRSQMPVSSQQASPCTPEQDWPCWTPCSPEGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKSLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PNPLA3 patatin like phospholipase domain containing 3 [ Homo sapiens (human) ] |
Official Symbol | PNPLA3 |
Synonyms | PNPLA3; patatin like phospholipase domain containing 3; ADPN; C22orf20; iPLA(2)epsilon; 1-acylglycerol-3-phosphate O-acyltransferase PNPLA3; acylglycerol O-acyltransferase; acylglycerol transacylase; adiponutrin; calcium-independent phospholipase A2-epsilon; iPLA2-epsilon; iPLA2epsilon; lysophosphatidic acid acyltransferase; patatin-like phospholipase domain-containing protein 3; EC 2.3.1.51; EC 3.1.1.3 |
Gene ID | 80339 |
mRNA Refseq | NM_025225 |
Protein Refseq | NP_079501 |
MIM | 609567 |
UniProt ID | Q9NST1 |
◆ Recombinant Proteins | ||
PNPLA3-27H | Recombinant Human PNPLA3 Protein (I148M Mutation), GST tagged | +Inquiry |
PNPLA3-1818H | Recombinant Human PNPLA3, GST-tagged | +Inquiry |
PNPLA3-367H | Recombinant Human PNPLA3 protein, MYC/DDK-tagged | +Inquiry |
PNPLA3-15HFL | Recombinant Human PNPLA3 Protein (Full Length), N-His tagged | +Inquiry |
PNPLA3-26HFL | Recombinant Full Length Human PNPLA3 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PNPLA3-3068HCL | Recombinant Human PNPLA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PNPLA3 Products
Required fields are marked with *
My Review for All PNPLA3 Products
Required fields are marked with *
0
Inquiry Basket