Recombinant Human PPIH

• Cat.No.: PPIH-30106TH
• Product Overview: Recombinant full length human PPIH; 177 amino acids, 19.2kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, PBS, pH 7.4
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTA ENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFV NGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN GCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTG PNNKPKLPVVISQCGEM
• Sequence Similarities: Belongs to the cyclophilin-type PPIase family. PPIase H subfamily.Contains 1 PPIase cyclophilin-type domain.
• Full Length: Full L.

Gene Information

• Gene Name: PPIH peptidylprolyl isomerase H (cyclophilin H) [ Homo sapiens ]
• Official Symbol: PPIH
• Synonyms: PPIH; peptidylprolyl isomerase H (cyclophilin H); peptidyl prolyl isomerase H (cyclophilin H); peptidyl-prolyl cis-trans isomerase H; cyclophilin H; CYP 20; CYPH; MGC5016; peptidyl prolyl cis trans isomerase H; PPIase h; rotamase H; small nuclear ribonucl
• Gene ID: 10465
• mRNA Refseq: NM_006347
• Protein Refseq: NP_006338
• MIM: 606095
• Uniprot ID: O43447
• Chromosome Location: 1p34.1
• Pathway: Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, U4/U6.U5 tri-snRNP, organism-specific biosystem
• Function: cyclosporin A binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; protein binding; ribonucleoprotein complex binding