Recombinant Human PPIH
Cat.No. : | PPIH-30106TH |
Product Overview : | Recombinant full length human PPIH; 177 amino acids, 19.2kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, PBS, pH 7.4 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTA ENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFV NGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN GCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTG PNNKPKLPVVISQCGEM |
Sequence Similarities : | Belongs to the cyclophilin-type PPIase family. PPIase H subfamily.Contains 1 PPIase cyclophilin-type domain. |
Full Length : | Full L. |
Gene Name | PPIH peptidylprolyl isomerase H (cyclophilin H) [ Homo sapiens ] |
Official Symbol | PPIH |
Synonyms | PPIH; peptidylprolyl isomerase H (cyclophilin H); peptidyl prolyl isomerase H (cyclophilin H); peptidyl-prolyl cis-trans isomerase H; cyclophilin H; CYP 20; CYPH; MGC5016; peptidyl prolyl cis trans isomerase H; PPIase h; rotamase H; small nuclear ribonucl |
Gene ID | 10465 |
mRNA Refseq | NM_006347 |
Protein Refseq | NP_006338 |
MIM | 606095 |
Uniprot ID | O43447 |
Chromosome Location | 1p34.1 |
Pathway | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, U4/U6.U5 tri-snRNP, organism-specific biosystem; |
Function | cyclosporin A binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; protein binding; ribonucleoprotein complex binding; |
◆ Recombinant Proteins | ||
PPIH-3549R | Recombinant Rhesus monkey PPIH Protein, His-tagged | +Inquiry |
PPIH-30685TH | Recombinant Human PPIH, T7 -tagged | +Inquiry |
Ppih-5043M | Recombinant Mouse Ppih Protein, Myc/DDK-tagged | +Inquiry |
PPIH-219H | Recombinant Human PPIH protein, T7-tagged | +Inquiry |
PPIH-5245C | Recombinant Chicken PPIH | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPIH-2969HCL | Recombinant Human PPIH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPIH Products
Required fields are marked with *
My Review for All PPIH Products
Required fields are marked with *