Recombinant Human PPP1R27 Protein, GST-tagged
Cat.No. : | PPP1R27-2995H |
Product Overview : | Human DYSFIP1 full-length ORF ( NP_001007534.1, 1 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | PPP1R27 (Protein Phosphatase 1 Regulatory Subunit 27) is a Protein Coding gene. GO annotations related to this gene include phosphatase binding and protein phosphatase inhibitor activity. An important paralog of this gene is NRARP. |
Molecular Mass : | 43.8 kDa |
AA Sequence : | MPSRTARYARYSPRQRRRRMLADRSVRFPNDVLFLDHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVKYGADIHQRDEAGWTPLHIACSDGYPDIARYLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PPP1R27 protein phosphatase 1 regulatory subunit 27 [ Homo sapiens (human) ] |
Official Symbol | PPP1R27 |
Synonyms | PPP1R27; protein phosphatase 1 regulatory subunit 27; Protein Phosphatase 1 Regulatory Subunit 27; Dysferlin-Interacting Protein 1 (Toonin); Dysferlin Interacting Protein 1; DYSFIP1; Toonin; Protein Phosphatase 1, Regulatory Subunit 27; Dysferlin Interacting Protein 1 (Toonin); Dysferlin-Interacting Protein 1; protein phosphatase 1 regulatory subunit 27; dysferlin interacting protein 1; dysferlin-interacting protein 1 (toonin); toonin |
Gene ID | 116729 |
mRNA Refseq | NM_001007533 |
Protein Refseq | NP_001007534 |
UniProt ID | Q86WC6 |
◆ Recombinant Proteins | ||
PPP1R27-2737H | Recombinant Human PPP1R27 Protein, MYC/DDK-tagged | +Inquiry |
Ppp1r27-5073M | Recombinant Mouse Ppp1r27 Protein, Myc/DDK-tagged | +Inquiry |
PPP1R27-4094HF | Recombinant Full Length Human PPP1R27 Protein, GST-tagged | +Inquiry |
PPP1R27-2995H | Recombinant Human PPP1R27 Protein, GST-tagged | +Inquiry |
PPP1R27-7018M | Recombinant Mouse PPP1R27 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1R27 Products
Required fields are marked with *
My Review for All PPP1R27 Products
Required fields are marked with *