Recombinant Human PPP1R27 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PPP1R27-3235H |
Product Overview : | DYSFIP1 MS Standard C13 and N15-labeled recombinant protein (NP_001007534) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Inhibits phosphatase activity of protein phosphatase 1 (PP1) complexes. |
Molecular Mass : | 17.4 kDa |
AA Sequence : | MPSRTARYARYSPRQRRRRMLADRSVRFPNDVLFLDHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVKYGADIHQRDEAGWTPLHIACSDGYPDIARYLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PPP1R27 protein phosphatase 1 regulatory subunit 27 [ Homo sapiens (human) ] |
Official Symbol | PPP1R27 |
Synonyms | protein phosphatase 1, regulatory subunit 27; 16813; Ensembl:ENSG00000182676; MGC138299; protein phosphatase 1 regulatory subunit 27;toonin;dysferlin interacting protein 1;dysferlin-interacting protein 1 (toonin); DYSFIP1 |
Gene ID | 116729 |
mRNA Refseq | NM_001007533 |
Protein Refseq | NP_001007534 |
UniProt ID | Q86WC6 |
◆ Recombinant Proteins | ||
PPP1R27-7018M | Recombinant Mouse PPP1R27 Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP1R27-2737H | Recombinant Human PPP1R27 Protein, MYC/DDK-tagged | +Inquiry |
PPP1R27-4094HF | Recombinant Full Length Human PPP1R27 Protein, GST-tagged | +Inquiry |
PPP1R27-2995H | Recombinant Human PPP1R27 Protein, GST-tagged | +Inquiry |
PPP1R27-3235H | Recombinant Human PPP1R27 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP1R27 Products
Required fields are marked with *
My Review for All PPP1R27 Products
Required fields are marked with *
0
Inquiry Basket