Recombinant Human PRDX2 Protein (2-198 aa), His-tagged

Cat.No. : PRDX2-2247H
Product Overview : Recombinant Human PRDX2 Protein (2-198 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 2-198 aa
Description : Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 23.8 kDa
AA Sequence : ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name PRDX2 peroxiredoxin 2 [ Homo sapiens ]
Official Symbol PRDX2
Synonyms PRDX2; peroxiredoxin 2; TDPX1; peroxiredoxin-2; MGC4104; NKEFB; PRP; PRX2; PRXII; thiol torin; TSA; NKEF-B; TPX1;
Gene ID 7001
mRNA Refseq NM_005809
Protein Refseq NP_005800
MIM 600538
UniProt ID P32119

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRDX2 Products

Required fields are marked with *

My Review for All PRDX2 Products

Required fields are marked with *

0
cart-icon
0
compare icon