Recombinant Human PRF1
| Cat.No. : | PRF1-29996TH |
| Product Overview : | Recombinant fragment of Human Perforin with proprietary tag, 36.08kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 95 amino acids |
| Description : | The protein encoded by this gene has structural and functional similarities to complement component 9 (C9). Like C9, this protein creates transmembrane tubules and is capable of lysing non-specifically a variety of target cells. This protein is one of the main cytolytic proteins of cytolytic granules, and it is known to be a key effector molecule for T-cell- and natural killer-cell-mediated cytolysis. Defects in this gene cause familial hemophagocytic lymphohistiocytosis type 2 (HPLH2), a rare and lethal autosomal recessive disorder of early childhood. Alternative splicing results in multiple transcript variants encoding the same protein. |
| Molecular Weight : | 36.080kDa inclusive of tags |
| Biological activity : | useful for Antibody Production and Protein Array |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HClNote: Glutathione is reduced |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | WSVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW |
| Sequence Similarities : | Belongs to the complement C6/C7/C8/C9 family.Contains 1 C2 domain.Contains 1 EGF-like domain.Contains 1 MACPF domain. |
| Gene Name | PRF1 perforin 1 (pore forming protein) [ Homo sapiens ] |
| Official Symbol | PRF1 |
| Synonyms | PRF1; perforin 1 (pore forming protein); perforin-1; HPLH2; P1; Perforin; perforin 1 (preforming protein); PFP; |
| Gene ID | 5551 |
| mRNA Refseq | NM_001083116 |
| Protein Refseq | NP_001076585 |
| MIM | 170280 |
| Uniprot ID | P14222 |
| Chromosome Location | 10q22 |
| Pathway | Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Apoptosis, organism-specific biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; |
| Function | calcium ion binding; protein binding; wide pore channel activity; |
| ◆ Recombinant Proteins | ||
| PRF1-326H | Recombinant Human PRF1 | +Inquiry |
| PRF1-01H | Recombinant Human PRF1 Protein, His-Tagged | +Inquiry |
| PRF1-3904H | Recombinant Human PRF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRF1-02H | Recombinant Human Perforin 1 Protein | +Inquiry |
| PRF1-738R | Recombinant Rat PRF1 Protein (25-554 aa), His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| PRF1-55H | Native Human Perforin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRF1-2873HCL | Recombinant Human PRF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRF1 Products
Required fields are marked with *
My Review for All PRF1 Products
Required fields are marked with *
