Recombinant Human PRF1
Cat.No. : | PRF1-29996TH |
Product Overview : | Recombinant fragment of Human Perforin with proprietary tag, 36.08kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 95 amino acids |
Description : | The protein encoded by this gene has structural and functional similarities to complement component 9 (C9). Like C9, this protein creates transmembrane tubules and is capable of lysing non-specifically a variety of target cells. This protein is one of the main cytolytic proteins of cytolytic granules, and it is known to be a key effector molecule for T-cell- and natural killer-cell-mediated cytolysis. Defects in this gene cause familial hemophagocytic lymphohistiocytosis type 2 (HPLH2), a rare and lethal autosomal recessive disorder of early childhood. Alternative splicing results in multiple transcript variants encoding the same protein. |
Molecular Weight : | 36.080kDa inclusive of tags |
Biological activity : | useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HClNote: Glutathione is reduced |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | WSVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW |
Sequence Similarities : | Belongs to the complement C6/C7/C8/C9 family.Contains 1 C2 domain.Contains 1 EGF-like domain.Contains 1 MACPF domain. |
Gene Name | PRF1 perforin 1 (pore forming protein) [ Homo sapiens ] |
Official Symbol | PRF1 |
Synonyms | PRF1; perforin 1 (pore forming protein); perforin-1; HPLH2; P1; Perforin; perforin 1 (preforming protein); PFP; |
Gene ID | 5551 |
mRNA Refseq | NM_001083116 |
Protein Refseq | NP_001076585 |
MIM | 170280 |
Uniprot ID | P14222 |
Chromosome Location | 10q22 |
Pathway | Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Apoptosis, organism-specific biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; |
Function | calcium ion binding; protein binding; wide pore channel activity; |
◆ Recombinant Proteins | ||
PRF1-738R | Recombinant Rat PRF1 Protein (25-554 aa), His-tagged | +Inquiry |
PRF1-158H | Active Recombinant Full Length Human PRF1 protein | +Inquiry |
PRF1-1931M | Recombinant Mouse PRF1 Protein (21-554 aa), His-tagged | +Inquiry |
PRF1-326H | Recombinant Human PRF1 | +Inquiry |
Prf1-25M | Recombinant Mouse Prf1 protein, His/GST-tagged | +Inquiry |
◆ Native Proteins | ||
PRF1-55H | Native Human Perforin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRF1-2873HCL | Recombinant Human PRF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRF1 Products
Required fields are marked with *
My Review for All PRF1 Products
Required fields are marked with *
0
Inquiry Basket