Recombinant Human PRF1

Cat.No. : PRF1-29996TH
Product Overview : Recombinant fragment of Human Perforin with proprietary tag, 36.08kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 95 amino acids
Description : The protein encoded by this gene has structural and functional similarities to complement component 9 (C9). Like C9, this protein creates transmembrane tubules and is capable of lysing non-specifically a variety of target cells. This protein is one of the main cytolytic proteins of cytolytic granules, and it is known to be a key effector molecule for T-cell- and natural killer-cell-mediated cytolysis. Defects in this gene cause familial hemophagocytic lymphohistiocytosis type 2 (HPLH2), a rare and lethal autosomal recessive disorder of early childhood. Alternative splicing results in multiple transcript variants encoding the same protein.
Molecular Weight : 36.080kDa inclusive of tags
Biological activity : useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HClNote: Glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : WSVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW
Sequence Similarities : Belongs to the complement C6/C7/C8/C9 family.Contains 1 C2 domain.Contains 1 EGF-like domain.Contains 1 MACPF domain.
Gene Name PRF1 perforin 1 (pore forming protein) [ Homo sapiens ]
Official Symbol PRF1
Synonyms PRF1; perforin 1 (pore forming protein); perforin-1; HPLH2; P1; Perforin; perforin 1 (preforming protein); PFP;
Gene ID 5551
mRNA Refseq NM_001083116
Protein Refseq NP_001076585
MIM 170280
Uniprot ID P14222
Chromosome Location 10q22
Pathway Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Apoptosis, organism-specific biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem;
Function calcium ion binding; protein binding; wide pore channel activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRF1 Products

Required fields are marked with *

My Review for All PRF1 Products

Required fields are marked with *

0
cart-icon
0
compare icon