Recombinant Human PRG2 protein, His-tagged
| Cat.No. : | PRG2-6654H |
| Product Overview : | Recombinant Human PRG2 protein(1-222 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-222 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGYWRRAHCLRRLPFICSY |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | PRG2 |
| Synonyms | PRG2; proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein); bone marrow proteoglycan; BMPG; MBP; bone-marrow proteoglycan; proteoglycan 2 preproprotein; natural killer cell activator; eosinophil major basic protein; eosinophil granule major basic protein; MBP1; MGC14537; |
| Gene ID | 5553 |
| mRNA Refseq | NM_001243245 |
| Protein Refseq | NP_001230174 |
| MIM | 605601 |
| UniProt ID | P13727 |
| ◆ Recombinant Proteins | ||
| Prg2-1746M | Recombinant Mouse Prg2 protein, His & GST-tagged | +Inquiry |
| PRG2-6654H | Recombinant Human PRG2 protein, His-tagged | +Inquiry |
| PRG2-19H | Recombinant Human PRG2 Protein (Leu17-End), N-His-ABP tagged | +Inquiry |
| PRG2-44H | Recombinant Human PRG2, His-tagged | +Inquiry |
| PRG2-1264H | Recombinant Human PRG2 Protein (Leu17-Tyr222), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRG2-2872HCL | Recombinant Human PRG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRG2 Products
Required fields are marked with *
My Review for All PRG2 Products
Required fields are marked with *
