Recombinant Human PRKAA1 protein, His-tagged
| Cat.No. : | PRKAA1-3871H |
| Product Overview : | Recombinant Human PRKAA1 protein(1-207 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | January 11, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-207 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRDCNIIRILTSQFTNYQH |
| Gene Name | PRKAA1 protein kinase, AMP-activated, alpha 1 catalytic subunit [ Homo sapiens ] |
| Official Symbol | PRKAA1 |
| Synonyms | PRKAA1; protein kinase, AMP-activated, alpha 1 catalytic subunit; 5-AMP-activated protein kinase catalytic subunit alpha-1; AMPK; alpha; 1; AMPKa1; AMPK alpha 1; AMPK subunit alpha-1; tau-protein kinase PRKAA1; AMP -activate kinase alpha 1 subunit; AMP-activated protein kinase, catalytic, alpha-1; 5-AMP-activated protein kinase, catalytic alpha-1 chain; MGC33776; MGC57364; |
| Gene ID | 5562 |
| mRNA Refseq | NM_006251 |
| Protein Refseq | NP_006242 |
| MIM | 602739 |
| UniProt ID | Q13131 |
| ◆ Recombinant Proteins | ||
| ACOX3-176H | Recombinant Human ACOX3 Protein, GST-Tagged | +Inquiry |
| ACOX3-9304H | Recombinant Human ACOX3, GST-tagged | +Inquiry |
| ACOX3-116R | Recombinant Rat ACOX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ACOX3-12363Z | Recombinant Zebrafish ACOX3 | +Inquiry |
| ACOX3-1210M | Recombinant Mouse ACOX3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACOX3 Products
Required fields are marked with *
My Review for All ACOX3 Products
Required fields are marked with *
