Recombinant Human PRKACA protein(11-350 aa), C-His-tagged
Cat.No. : | PRKACA-2674H |
Product Overview : | Recombinant Human PRKACA protein(P17612)(11-350 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 11-350 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | SEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSE |
Gene Name | PRKACA protein kinase, cAMP-dependent, catalytic, alpha [ Homo sapiens ] |
Official Symbol | PRKACA |
Synonyms | PRKACA; protein kinase, cAMP-dependent, catalytic, alpha; cAMP-dependent protein kinase catalytic subunit alpha; PKACa; PKA C-alpha; protein kinase A catalytic subunit; cAMP-dependent protein kinase catalytic subunit alpha, isoform 1; PKACA; MGC48865; MGC102831; |
Gene ID | 5566 |
mRNA Refseq | NM_002730 |
Protein Refseq | NP_002721 |
MIM | 601639 |
UniProt ID | P17612 |
◆ Recombinant Proteins | ||
PRKACA-1917H | Recombinant Human PRKACA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRKACA-4494D | Recombinant Dog PRKACA protein, His-tagged | +Inquiry |
PRKACA-2952H | Recombinant Human PRKACA Protein, MYC/DDK-tagged | +Inquiry |
PRKACA-3371H | Recombinant Human PRKACA protein, His-tagged | +Inquiry |
PRKACA-0817H | Recombinant Human PRKACA Protein (G2-F351), GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRKACA-1415HCL | Recombinant Human PRKACA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKACA Products
Required fields are marked with *
My Review for All PRKACA Products
Required fields are marked with *