Recombinant Human PRKACA protein(11-350 aa), C-His-tagged

Cat.No. : PRKACA-2674H
Product Overview : Recombinant Human PRKACA protein(P17612)(11-350 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 11-350 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : SEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSE
Gene Name PRKACA protein kinase, cAMP-dependent, catalytic, alpha [ Homo sapiens ]
Official Symbol PRKACA
Synonyms PRKACA; protein kinase, cAMP-dependent, catalytic, alpha; cAMP-dependent protein kinase catalytic subunit alpha; PKACa; PKA C-alpha; protein kinase A catalytic subunit; cAMP-dependent protein kinase catalytic subunit alpha, isoform 1; PKACA; MGC48865; MGC102831;
Gene ID 5566
mRNA Refseq NM_002730
Protein Refseq NP_002721
MIM 601639
UniProt ID P17612

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRKACA Products

Required fields are marked with *

My Review for All PRKACA Products

Required fields are marked with *

0
cart-icon
0
compare icon