Recombinant Human PRKACA protein(11-350 aa), C-His-tagged
| Cat.No. : | PRKACA-2674H |
| Product Overview : | Recombinant Human PRKACA protein(P17612)(11-350 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 11-350 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | SEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSE |
| Gene Name | PRKACA protein kinase, cAMP-dependent, catalytic, alpha [ Homo sapiens ] |
| Official Symbol | PRKACA |
| Synonyms | PRKACA; protein kinase, cAMP-dependent, catalytic, alpha; cAMP-dependent protein kinase catalytic subunit alpha; PKACa; PKA C-alpha; protein kinase A catalytic subunit; cAMP-dependent protein kinase catalytic subunit alpha, isoform 1; PKACA; MGC48865; MGC102831; |
| Gene ID | 5566 |
| mRNA Refseq | NM_002730 |
| Protein Refseq | NP_002721 |
| MIM | 601639 |
| UniProt ID | P17612 |
| ◆ Recombinant Proteins | ||
| PRKACA-2080HF | Active Recombinant Full Length Human PRKACA Protein, GST-tagged | +Inquiry |
| PRKACA-2051HF | Active Recombinant Full Length Human PRKACA Protein, DDK-tagged, Biotinylated | +Inquiry |
| PRKACA-1658C | Recombinant Canine PRKACA protein, His-tagged | +Inquiry |
| PRKACA-2674H | Recombinant Human PRKACA protein(11-350 aa), C-His-tagged | +Inquiry |
| PRKACA-55643H | Recombinant Human PRKACA, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRKACA-1415HCL | Recombinant Human PRKACA cell lysate | +Inquiry |
| PRKACA-491HKCL | Human PRKACA Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKACA Products
Required fields are marked with *
My Review for All PRKACA Products
Required fields are marked with *
