Recombinant Human PRKACA protein, His-tagged
| Cat.No. : | PRKACA-3369H |
| Product Overview : | Recombinant Human PRKACA protein(P17612)(2-351aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-351aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 44.5 |
| AA Sequence : | GNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PRKACA protein kinase, cAMP-dependent, catalytic, alpha [ Homo sapiens ] |
| Official Symbol | PRKACA |
| Synonyms | PRKACA; protein kinase, cAMP-dependent, catalytic, alpha; cAMP-dependent protein kinase catalytic subunit alpha; PKACa; PKA C-alpha; protein kinase A catalytic subunit; cAMP-dependent protein kinase catalytic subunit alpha, isoform 1; PKACA; MGC48865; MGC102831; |
| Gene ID | 5566 |
| mRNA Refseq | NM_002730 |
| Protein Refseq | NP_002721 |
| MIM | 601639 |
| UniProt ID | P17612 |
| ◆ Recombinant Proteins | ||
| PRKACA-2051HF | Active Recombinant Full Length Human PRKACA Protein, DDK-tagged, Biotinylated | +Inquiry |
| PRKACA-0816H | Recombinant Human PRKACA Protein (G2-F351), Tag Free | +Inquiry |
| PRKACA-55643H | Recombinant Human PRKACA, GST-tagged | +Inquiry |
| PRKACA-2674H | Recombinant Human PRKACA protein(11-350 aa), C-His-tagged | +Inquiry |
| PRKACA-1917H | Recombinant Human PRKACA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRKACA-1415HCL | Recombinant Human PRKACA cell lysate | +Inquiry |
| PRKACA-491HKCL | Human PRKACA Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKACA Products
Required fields are marked with *
My Review for All PRKACA Products
Required fields are marked with *
