Recombinant Human PRMT2 protein, His-tagged

Cat.No. : PRMT2-3251H
Product Overview : Recombinant Human PRMT2 protein(1-140 aa), fused to His tag, was expressed in E. coli.
Availability January 29, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-140 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKV
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PRMT2 protein arginine methyltransferase 2 [ Homo sapiens ]
Official Symbol PRMT2
Synonyms PRMT2; protein arginine methyltransferase 2; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 1 , HMT1 hnRNP methyltransferase like 1 (S. cerevisiae) , HRMT1L1; protein arginine N-methyltransferase 2; MGC111373; PRMT2 beta; PRMT2 alpha; PRMT2 gamma; HMT1 hnRNP methyltransferase-like 1; histone-arginine N-methyltransferase PRMT2; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1; HRMT1L1;
Gene ID 3275
mRNA Refseq NM_001242864
Protein Refseq NP_001229793
MIM 601961
UniProt ID P55345

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRMT2 Products

Required fields are marked with *

My Review for All PRMT2 Products

Required fields are marked with *

0
cart-icon
0
compare icon