Recombinant Human PRMT2 protein, His-tagged
| Cat.No. : | PRMT2-3251H |
| Product Overview : | Recombinant Human PRMT2 protein(1-140 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 12, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-140 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PRMT2 protein arginine methyltransferase 2 [ Homo sapiens ] |
| Official Symbol | PRMT2 |
| Synonyms | PRMT2; protein arginine methyltransferase 2; HMT1 (hnRNP methyltransferase, S. cerevisiae) like 1 , HMT1 hnRNP methyltransferase like 1 (S. cerevisiae) , HRMT1L1; protein arginine N-methyltransferase 2; MGC111373; PRMT2 beta; PRMT2 alpha; PRMT2 gamma; HMT1 hnRNP methyltransferase-like 1; histone-arginine N-methyltransferase PRMT2; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1; HRMT1L1; |
| Gene ID | 3275 |
| mRNA Refseq | NM_001242864 |
| Protein Refseq | NP_001229793 |
| MIM | 601961 |
| UniProt ID | P55345 |
| ◆ Recombinant Proteins | ||
| PRMT2-5188H | Recombinant Human PRMT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PRMT2-125H | Recombinant Human PRMT2 protein, GST-tagged | +Inquiry |
| PRMT2-12H | Recombinant Full Length Human PRMT2 protein, GST-tagged | +Inquiry |
| PRMT2-3251H | Recombinant Human PRMT2 protein, His-tagged | +Inquiry |
| PRMT2-634HF | Recombinant Full Length Human PRMT2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRMT2-2839HCL | Recombinant Human PRMT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRMT2 Products
Required fields are marked with *
My Review for All PRMT2 Products
Required fields are marked with *
