Recombinant Human PRMT5 protein, His-tagged
Cat.No. : | PRMT5-3528H |
Product Overview : | Recombinant Human PRMT5 protein(283-637 aa), fused to His tag, was expressed in E. coli. |
Availability | September 19, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 283-637 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | YLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PRMT5 protein arginine methyltransferase 5 [ Homo sapiens ] |
Official Symbol | PRMT5 |
Synonyms | PRMT5; protein arginine methyltransferase 5; HRMT1L5, SKB1, skb1 (S. pombe) homolog , SKB1 homolog (S. pombe); protein arginine N-methyltransferase 5; SKB1Hs; SKB1 homolog; jak-binding protein 1; 72 kDa ICln-binding protein; HMT1 hnRNP methyltransferase-like 5; shk1 kinase-binding protein 1 homolog; histone-arginine N-methyltransferase PRMT5; JBP1; SKB1; IBP72; HRMT1L5; |
Gene ID | 10419 |
mRNA Refseq | NM_001039619 |
Protein Refseq | NP_001034708 |
MIM | 604045 |
UniProt ID | O14744 |
◆ Recombinant Proteins | ||
PRMT5-3004H | Recombinant Human PRMT5 Protein, MYC/DDK-tagged | +Inquiry |
PRMT5-688HFL | Recombinant Full Length Human PRMT5 Protein, C-Flag-tagged | +Inquiry |
PRMT5-4447H | Recombinant Human PRMT5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRMT5-2321H | Recombinant Human PRMT5 protein, His&FLAG-tagged | +Inquiry |
PRMT5&MEP50-315H | Recombinant Human PRMT5&MEP50 protein, Flag/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRMT5-2577HCL | Recombinant Human PRMT5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRMT5 Products
Required fields are marked with *
My Review for All PRMT5 Products
Required fields are marked with *