Recombinant Human PRMT6 Protein, GST-tagged
Cat.No. : | PRMT6-5044H |
Product Overview : | Human HRMT1L6 partial ORF ( NP_060607, 241 a.a. - 316 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Protein arginine N-methyltransferases, such as PRMT6, catalyze the sequential transfer of a methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins to form methylated arginine derivatives and S-adenosyl-L-homocysteine.[supplied by OMIM |
Molecular Mass : | 34.1 kDa |
AA Sequence : | ESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAMED |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PRMT6 protein arginine methyltransferase 6 [ Homo sapiens ] |
Official Symbol | PRMT6 |
Synonyms | PRMT6; protein arginine methyltransferase 6; HMT1 hnRNP methyltransferase like 6 (S. cerevisiae) , HRMT1L6; protein arginine N-methyltransferase 6; FLJ10559; HMT1 hnRNP methyltransferase-like 6; histone-arginine N-methyltransferase PRMT6; heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6; HRMT1L6; FLJ51477; |
Gene ID | 55170 |
mRNA Refseq | NM_018137 |
Protein Refseq | NP_060607 |
MIM | 608274 |
UniProt ID | Q96LA8 |
◆ Recombinant Proteins | ||
PRMT6-318H | Recombinant Human PRMT6 Protein, His & FLAG-tagged | +Inquiry |
PRMT6-044H | Recombinant Human PRMT6 Protein, His-tagged | +Inquiry |
PRMT6-7126M | Recombinant Mouse PRMT6 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRMT6-3433R | Recombinant Rhesus Macaque PRMT6 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRMT6-7567Z | Recombinant Zebrafish PRMT6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRMT6-2458HCL | Recombinant Human PRMT6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRMT6 Products
Required fields are marked with *
My Review for All PRMT6 Products
Required fields are marked with *
0
Inquiry Basket