Recombinant Human PRMT6 Protein, GST-tagged

Cat.No. : PRMT6-5044H
Product Overview : Human HRMT1L6 partial ORF ( NP_060607, 241 a.a. - 316 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Protein arginine N-methyltransferases, such as PRMT6, catalyze the sequential transfer of a methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins to form methylated arginine derivatives and S-adenosyl-L-homocysteine.[supplied by OMIM
Molecular Mass : 34.1 kDa
AA Sequence : ESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAMED
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PRMT6 protein arginine methyltransferase 6 [ Homo sapiens ]
Official Symbol PRMT6
Synonyms PRMT6; protein arginine methyltransferase 6; HMT1 hnRNP methyltransferase like 6 (S. cerevisiae) , HRMT1L6; protein arginine N-methyltransferase 6; FLJ10559; HMT1 hnRNP methyltransferase-like 6; histone-arginine N-methyltransferase PRMT6; heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6; HRMT1L6; FLJ51477;
Gene ID 55170
mRNA Refseq NM_018137
Protein Refseq NP_060607
MIM 608274
UniProt ID Q96LA8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRMT6 Products

Required fields are marked with *

My Review for All PRMT6 Products

Required fields are marked with *

0
cart-icon