Recombinant Human Proinsulin protein

• Cat.No.: INS-315H
• Product Overview: Recombinant Human Proinsulin(Phe25 -Asn110) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 25-110 aa
• Description: After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 9394.67 Da
• AA Sequence: FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTS ICSLYQLENYCN
• Purity: >99%
• Storage: Lyophilized peptide is shipped at ambient temperature.12 months from date of receipt, -20°C to -70 °C as supplied.3 months, -20°C to -70 °C under sterile conditions after reconstitution.1 month, 2 to 8 °C under sterile conditions after reconstitution.Avoid multiple freeze-thaw cycles.
• Reconstitution: Reconstitute to 1.0mg/mL in sterile phosphate buffered saline.
• Publications:
  Proinsulin folding and trafficking defects trigger a common pathological disturbance of endoplasmic reticulum homeostasis (2024)

Gene Information

• Gene Name: INS insulin [ Homo sapiens ]
• Official Symbol: INS
• Synonyms: INS; insulin; proinsulin; ILPR; IRDN; IDDM2; MODY10
• Gene ID: 3630
• mRNA Refseq: NM_000207
• Protein Refseq: NP_000198
• MIM: 176730
• UniProt ID: P01308
• Chromosome Location: 11p15.5
• Pathway: ATF-2 transcription factor network, organism-specific biosystem; Adipogenesis, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Amyloids, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Developmental Biology, organism-specific biosystem
• Function: hormone activity; hormone activity; hormone activity; insulin receptor binding; insulin receptor binding; insulin-like growth factor receptor binding; protein binding