Recombinant Human Proinsulin protein

Cat.No. : INS-315H
Product Overview : Recombinant Human Proinsulin(Phe25 -Asn110) was expressed in E. coli.
Availability October 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 25-110 aa
Description : After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. Alternative splicing results in multiple transcript variants.
Molecular Mass : 9394.67 Da
AA Sequence : FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTS ICSLYQLENYCN
Purity : >99%
Storage : Lyophilized peptide is shipped at ambient temperature.12 months from date of receipt, -20°C to -70 °C as supplied.3 months, -20°C to -70 °C under sterile conditions after reconstitution.1 month, 2 to 8 °C under sterile conditions after reconstitution.Avoid multiple freeze-thaw cycles.
Reconstitution : Reconstitute to 1.0mg/mL in sterile phosphate buffered saline.
Publications :
Proinsulin folding and trafficking defects trigger a common pathological disturbance of endoplasmic reticulum homeostasis (2024)
Gene Name INS insulin [ Homo sapiens ]
Official Symbol INS
Synonyms INS; insulin; proinsulin; ILPR; IRDN; IDDM2; MODY10;
Gene ID 3630
mRNA Refseq NM_000207
Protein Refseq NP_000198
MIM 176730
UniProt ID P01308
Chromosome Location 11p15.5
Pathway ATF-2 transcription factor network, organism-specific biosystem; Adipogenesis, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Amyloids, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Developmental Biology, organism-specific biosystem;
Function hormone activity; hormone activity; hormone activity; insulin receptor binding; insulin receptor binding; insulin-like growth factor receptor binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INS Products

Required fields are marked with *

My Review for All INS Products

Required fields are marked with *

0
cart-icon
0
compare icon