"INS" Related Products

Recombinant Human Proinsulin protein

Cat.No.: INS-315H
Product Overview: Recombinant Human Proinsulin(Phe25 -Asn110) was expressed in E. coli.
Description: After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. Alternative splicing results in multiple transcript variants.
Source: E. coli
Species: Human
Molecular Mass: 9394.67 Da
AA Sequence: FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTS ICSLYQLENYCN
Purity: >99%
Storage: Lyophilized peptide is shipped at ambient temperature.12 months from date of receipt, -20°C to -70 °C as supplied.3 months, -20°C to -70 °C under sterile conditions after reconstitution.1 month, 2 to 8 °C under sterile conditions after reconstitution.Avoid multiple freeze-thaw cycles.
Reconstitution: Reconstitute to 1.0mg/mL in sterile phosphate buffered saline.
Gene Name: INS insulin [ Homo sapiens ]
Official Symbol: INS
Synonyms: INS; insulin; proinsulin; ILPR; IRDN; IDDM2; MODY10;
Gene ID: 3630
mRNA Refseq: NM_000207
Protein Refseq: NP_000198
MIM: 176730
UniProt ID: P01308
Chromosome Location: 11p15.5
Pathway: ATF-2 transcription factor network, organism-specific biosystem; Adipogenesis, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Amyloids, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Developmental Biology, organism-specific biosystem;
Function: hormone activity; hormone activity; hormone activity; insulin receptor binding; insulin receptor binding; insulin-like growth factor receptor binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.