Recombinant Human Proinsulin protein
| Cat.No. : | INS-315H |
| Product Overview : | Recombinant Human Proinsulin(Phe25 -Asn110) was expressed in E. coli. |
| Availability | February 06, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 25-110 aa |
| Description : | After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | 9394.67 Da |
| AA Sequence : | FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTS ICSLYQLENYCN |
| Purity : | >99% |
| Storage : | Lyophilized peptide is shipped at ambient temperature.12 months from date of receipt, -20°C to -70 °C as supplied.3 months, -20°C to -70 °C under sterile conditions after reconstitution.1 month, 2 to 8 °C under sterile conditions after reconstitution.Avoid multiple freeze-thaw cycles. |
| Reconstitution : | Reconstitute to 1.0mg/mL in sterile phosphate buffered saline. |
| Publications : |
| Gene Name | INS insulin [ Homo sapiens ] |
| Official Symbol | INS |
| Synonyms | INS; insulin; proinsulin; ILPR; IRDN; IDDM2; MODY10; |
| Gene ID | 3630 |
| mRNA Refseq | NM_000207 |
| Protein Refseq | NP_000198 |
| MIM | 176730 |
| UniProt ID | P01308 |
| Chromosome Location | 11p15.5 |
| Pathway | ATF-2 transcription factor network, organism-specific biosystem; Adipogenesis, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Amyloids, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Developmental Biology, organism-specific biosystem; |
| Function | hormone activity; hormone activity; hormone activity; insulin receptor binding; insulin receptor binding; insulin-like growth factor receptor binding; protein binding; |
| ◆ Recombinant Proteins | ||
| INS-61H | Recombinant Human INS Protein | +Inquiry |
| INS-369C | Recombinant Cynomolgus Monkey INS Protein, His (Fc)-Avi-tagged | +Inquiry |
| INS-0301H | Active Recombinant Human INS protein | +Inquiry |
| INS-320H | Active Recombinant Human INS | +Inquiry |
| INS-5978HF | Recombinant Full Length Human INS Protein, GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| INS-512D | Native Bovine INS | +Inquiry |
| INS-5435B | Native Bovine Insulin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INS-5195HCL | Recombinant Human INS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INS Products
Required fields are marked with *
My Review for All INS Products
Required fields are marked with *
