Recombinant Human PROM1 Protein (508-792 aa), His-tagged
Cat.No. : | PROM1-1493H |
Product Overview : | Recombinant Human PROM1 Protein (508-792 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 508-792 aa |
Description : | May play a role in cell differentiation, proliferation and apoptosis . Binds cholesterol in cholesterol-containing plasma mbrane microdomains and may play a role in the organization of the apical plasma mbrane in epithelial cells. During early retinal development acts as a key regulator of disk morphogenesis. Involved in regulation of MAPK and Akt signaling pathways. In neuroblastoma cells suppresses cell differentiation such as neurite outgrowth in a RET-dependent manner. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 34.2 kDa |
AA Sequence : | GANVEKLICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPLN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | PROM1 prominin 1 [ Homo sapiens ] |
Official Symbol | PROM1 |
Synonyms | PROM1; prominin 1; prominin-1; AC133; CD133; RP41; MCDR2; STGD4; CORD12; PROML1; MSTP061; |
Gene ID | 8842 |
mRNA Refseq | NM_001145847 |
Protein Refseq | NP_001139319 |
MIM | 604365 |
UniProt ID | O43490 |
◆ Recombinant Proteins | ||
PROM1-1493H | Recombinant Human PROM1 Protein (508-792 aa), His-tagged | +Inquiry |
PROM1-456H | Active Recombinant Human PROM1 protein, His-Avi-tagged, Biotinylated(Detergent) | +Inquiry |
PROM1-247H | Recombinant Human PROM1 protein, hFc-tagged | +Inquiry |
PROM1-1381H | Recombinant Human PROM1 Protein (Leu805-Ans865), N-GST tagged | +Inquiry |
PROM1-161H | Recombinant Human PROM1 Protein, C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PROM1-981RCL | Recombinant Rat PROM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PROM1 Products
Required fields are marked with *
My Review for All PROM1 Products
Required fields are marked with *
0
Inquiry Basket