Recombinant Human PROM1 Protein (508-792 aa), His-tagged

Cat.No. : PROM1-1493H
Product Overview : Recombinant Human PROM1 Protein (508-792 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 508-792 aa
Description : May play a role in cell differentiation, proliferation and apoptosis . Binds cholesterol in cholesterol-containing plasma mbrane microdomains and may play a role in the organization of the apical plasma mbrane in epithelial cells. During early retinal development acts as a key regulator of disk morphogenesis. Involved in regulation of MAPK and Akt signaling pathways. In neuroblastoma cells suppresses cell differentiation such as neurite outgrowth in a RET-dependent manner.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 34.2 kDa
AA Sequence : GANVEKLICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPLN
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name PROM1 prominin 1 [ Homo sapiens ]
Official Symbol PROM1
Synonyms PROM1; prominin 1; prominin-1; AC133; CD133; RP41; MCDR2; STGD4; CORD12; PROML1; MSTP061;
Gene ID 8842
mRNA Refseq NM_001145847
Protein Refseq NP_001139319
MIM 604365
UniProt ID O43490

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PROM1 Products

Required fields are marked with *

My Review for All PROM1 Products

Required fields are marked with *

0
cart-icon