Recombinant Human Prominin 1, GST-tagged
Cat.No. : | PROM1-73H |
Product Overview : | Recombinant Human PROM1 (693 a.a. - 790 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. Mutations in this gene have been shown to result in retinitis pigmentosa and Stargardt disease. Expression of this gene is also associated with several types of cancer. This gene is expressed from at least five alternative promoters that are expressed in a tissue-dependent manner. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 36.52 kDa |
Sequence : | STLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDP |
Storagebuffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Applications : | ELISA; WB |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
OfficialSymbol : | PROM1 |
Gene Name | PROM1 prominin 1 [Homo sapiens] |
Synonyms | prominin 1; prominin (mouse)-like 1; AC133; Stargardt disease 4 (autosomal dominant); CD133; OTTHUMP00000217744; RP41; OTTHUMP00000217745; PROML1; OTTHUMP00000217746; Antigen AC133; hProminin; Prominin-like protein 1; hematopoietic stem cell antigen; CORD12; prominin-1; MCDR2; prominin-like 1; STGD4; CD133 antigen; macular dystrophy, retinal 2; MSTP061 |
Gene ID | 8842 |
mRNA Refseq | NM_006017 |
Protein Refseq | NP_006008 |
MIM | 604365 |
UniProt ID | O43490 |
Chromosome Location | 4p15.32 |
Function | actinin binding; cadherin binding; protein binding |
◆ Recombinant Proteins | ||
PROM1-2795H | Recombinant Human PROM1 Protein (Gly508-Asn792), His tagged | +Inquiry |
PROM1-399HF | Recombinant Full Length Human PROM1 Protein | +Inquiry |
PROM1-247H | Recombinant Human PROM1 protein, hFc-tagged | +Inquiry |
Prom1-120RAF647 | Recombinant Rat Prom1 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
PROM1-3437R | Recombinant Rhesus Macaque PROM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PROM1-981RCL | Recombinant Rat PROM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PROM1 Products
Required fields are marked with *
My Review for All PROM1 Products
Required fields are marked with *