Recombinant Human Prominin 1, GST-tagged

Cat.No. : PROM1-73H
Product Overview : Recombinant Human PROM1 (693 a.a. - 790 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. Mutations in this gene have been shown to result in retinitis pigmentosa and Stargardt disease. Expression of this gene is also associated with several types of cancer. This gene is expressed from at least five alternative promoters that are expressed in a tissue-dependent manner. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 36.52 kDa
Sequence : STLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDP
Storagebuffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications : ELISA; WB
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol : PROM1
Gene Name PROM1 prominin 1 [Homo sapiens]
Synonyms prominin 1; prominin (mouse)-like 1; AC133; Stargardt disease 4 (autosomal dominant); CD133; OTTHUMP00000217744; RP41; OTTHUMP00000217745; PROML1; OTTHUMP00000217746; Antigen AC133; hProminin; Prominin-like protein 1; hematopoietic stem cell antigen; CORD12; prominin-1; MCDR2; prominin-like 1; STGD4; CD133 antigen; macular dystrophy, retinal 2; MSTP061
Gene ID 8842
mRNA Refseq NM_006017
Protein Refseq NP_006008
MIM 604365
UniProt ID O43490
Chromosome Location 4p15.32
Function actinin binding; cadherin binding; protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PROM1 Products

Required fields are marked with *

My Review for All PROM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon