Recombinant Human PRPS2 protein, His-tagged

• Cat.No.: PRPS2-5743H
• Product Overview: Recombinant Human PRPS2 protein(143-273 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 143-273 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: IPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVV
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: PRPS2 phosphoribosyl pyrophosphate synthetase 2 [ Homo sapiens ]
• Official Symbol: PRPS2
• Synonyms: PRPS2; phosphoribosyl pyrophosphate synthetase 2; ribose-phosphate pyrophosphokinase 2; PRS II; ribose phosphate diphosphokinase 2; PRS-II; PPRibP synthetase; ribose-phosphate diphosphokinase 2; phosphoribosyl pyrophosphate synthase II; PRSII
• Gene ID: 5634
• mRNA Refseq: NM_001039091
• Protein Refseq: NP_001034180
• MIM: 311860
• UniProt ID: P11908