Recombinant Human PSCA protein, His&His-tagged
| Cat.No. : | PSCA-3379H |
| Product Overview : | Recombinant Human PSCA protein(O43653)(13-86aa), fused to N-terminal His tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 13-86aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 13.4 kDa |
| AA Sequence : | LCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PSCA prostate stem cell antigen [ Homo sapiens ] |
| Official Symbol | PSCA |
| Synonyms | PSCA; prostate stem cell antigen; PRO232; |
| Gene ID | 8000 |
| mRNA Refseq | NM_005672 |
| Protein Refseq | NP_005663 |
| MIM | 602470 |
| UniProt ID | O43653 |
| ◆ Recombinant Proteins | ||
| PSCA-1495M | Recombinant Mouse PSCA Protein (21-95 aa), His-tagged | +Inquiry |
| PSCA-3061H | Recombinant Human PSCA Protein, DDK-tagged | +Inquiry |
| PSCA-08H | Recombinant Human prostate stem cell antigen, GST tagged, GFP Labeled | +Inquiry |
| PSCA-3378H | Recombinant Human PSCA protein, GST-tagged | +Inquiry |
| PSCA-3379H | Recombinant Human PSCA protein, His&His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSCA-2791HCL | Recombinant Human PSCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSCA Products
Required fields are marked with *
My Review for All PSCA Products
Required fields are marked with *




