Recombinant Human PSMA1 protein, His-tagged
Cat.No. : | PSMA1-3380H |
Product Overview : | Recombinant Human PSMA1 protein(P25786)(1-251aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-251aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.2 kDa |
AA Sequence : | MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPAD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PSMA1 proteasome (prosome, macropain) subunit, alpha type, 1 [ Homo sapiens ] |
Official Symbol | PSMA1 |
Synonyms | PSMA1; proteasome (prosome, macropain) subunit, alpha type, 1; proteasome subunit alpha type-1; HC2; MGC1667; MGC14542; MGC14575; MGC14751; MGC21459; MGC22853; MGC23915; NU; PROS30; PROS-30; protein P30-33K; proteasome nu chain; macropain subunit C2; macropain subunit nu; proteasome subunit nu; 30 kDa prosomal protein; proteasome component C2; proteasome subunit, alpha-type, 1; multicatalytic endopeptidase complex subunit C2; |
Gene ID | 5682 |
mRNA Refseq | NM_001143937 |
Protein Refseq | NP_001137409 |
MIM | 602854 |
UniProt ID | P25786 |
◆ Recombinant Proteins | ||
PSMA1-2009H | Recombinant Human PSMA1, GST-tagged | +Inquiry |
PSMA1-560C | Recombinant Cynomolgus Monkey PSMA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSMA1-4421R | Recombinant Rat PSMA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSMA1-817C | Recombinant Cynomolgus PSMA1 Protein, His-tagged | +Inquiry |
PSMA1-001H | Recombinant Human proteasome 20S subunit alpha 1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMA1-2780HCL | Recombinant Human PSMA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMA1 Products
Required fields are marked with *
My Review for All PSMA1 Products
Required fields are marked with *