Recombinant Human PTPN22 Protein (1-179), N-GST tagged
| Cat.No. : | PTPN22-11H |
| Product Overview : | Human PTPN22 full-length ORF ( AAH17785, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro). |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-179 |
| Description : | This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family. The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, rheumatoid arthritis, systemic lupus erythematosus and Graves' disease. Alternatively spliced transcript variants encoding distinct isoforms have been described. |
| Molecular Mass : | 45.43 kDa |
| AA Sequence : | MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKEAEKRKSDYIIRTLKVKFNSVSVILAHQTSLQNLFSQITPAHF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | PTPN22 protein tyrosine phosphatase non-receptor type 22 [ Homo sapiens (human) ] |
| Official Symbol | PTPN22 |
| Synonyms | PTPN22; protein tyrosine phosphatase non-receptor type 22; LYP; PEP; LYP1; LYP2; PTPN8; PTPN22.5; PTPN22.6; tyrosine-protein phosphatase non-receptor type 22; PEST-domain phosphatase; hematopoietic cell protein-tyrosine phosphatase 70Z-PEP; lymphoid-specific protein tyrosine phosphatase; protein tyrosine phosphatase, non-receptor type 22 (lymphoid); protein tyrosine phosphatase, non-receptor type 8; EC 3.1.3.48 |
| Gene ID | 26191 |
| mRNA Refseq | NM_015967 |
| Protein Refseq | NP_057051 |
| MIM | 600716 |
| UniProt ID | Q9Y2R2 |
| ◆ Recombinant Proteins | ||
| PTPN22-5765Z | Recombinant Zebrafish PTPN22 | +Inquiry |
| PTPN22-13683M | Recombinant Mouse PTPN22 Protein | +Inquiry |
| PTPN22-3523R | Recombinant Rhesus Macaque PTPN22 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PTPN22-11H | Recombinant Human PTPN22 Protein (1-179), N-GST tagged | +Inquiry |
| PTPN22-01H | Recombinant Human PTPN22 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PTPN22-2684HCL | Recombinant Human PTPN22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTPN22 Products
Required fields are marked with *
My Review for All PTPN22 Products
Required fields are marked with *
