Recombinant Human RAB8A Protein, His-tagged

• Cat.No.: RAB8A-32H
• Product Overview: Recombinant Human RAB8A Protein(P61006)(91-190 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 91-190 aa
• Form: Phosphate buffered saline.
• Molecular Mass: 13 kDa
• AASequence: TNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVK
• Storage: Store at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: RAB8A RAB8A, member RAS oncogene family [ Homo sapiens ]
• Official Symbol: RAB8A
• Synonyms: RAB8A; RAB8A, member RAS oncogene family; MEL, mel transforming oncogene (derived from cell line NK14); ras-related protein Rab-8A; RAB8; oncogene c-mel; ras-associated protein RAB8; mel transforming oncogene (RAB8 homolog); mel transforming oncogene (derived from cell line NK14); mel transforming oncogene (derived from cell line NK14)- RAB8 homolog; MEL
• Gene ID: 4218
• mRNA Refseq: NM_005370
• Protein Refseq: NP_005361
• MIM: 165040
• UniProt ID: P61006