Recombinant Human RAET1E protein, His-tagged
| Cat.No. : | RAET1E-2937H |
| Product Overview : | Recombinant Human RAET1E protein(95-190 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | November 20, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 95-190 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | GEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQHEAERCTGASWQFTINGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCD |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | RAET1E retinoic acid early transcript 1E [ Homo sapiens ] |
| Official Symbol | RAET1E |
| Synonyms | RAET1E; retinoic acid early transcript 1E; NKG2D ligand 4; bA350J20.7; LETAL; ULBP4; RAE-1-like transcript 4; lymphocyte effector toxicity activation ligand; RL-4; N2DL-4; NKG2DL4; RAET1E2; MGC125308; MGC125309; |
| mRNA Refseq | NM_001243325 |
| Protein Refseq | NP_001230254 |
| MIM | 609243 |
| UniProt ID | Q8TD07 |
| Gene ID | 135250 |
| ◆ Recombinant Proteins | ||
| RAET1E-764H | Recombinant Human RAET1E Protein, Fc-tagged | +Inquiry |
| RAET1E-381H | Recombinant Human retinoic acid early transcript 1E, His-tagged | +Inquiry |
| RAET1E-2937H | Recombinant Human RAET1E protein, His-tagged | +Inquiry |
| RAET1E-209H | Recombinant Human RAET1E Protein, hIgG-His-tagged | +Inquiry |
| RAET1E-206H | Recombinant Human RAET1E Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAET1E-2549HCL | Recombinant Human RAET1E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAET1E Products
Required fields are marked with *
My Review for All RAET1E Products
Required fields are marked with *
