Recombinant Mouse Raet1e Protein, His tagged

Cat.No. : Raet1e-02M
Product Overview : Recombinant mouse Raet1e (29-227 aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect cells
Tag : His
Protein Length : 29-227 aa
Description : Enables natural killer cell lectin-like receptor binding activity. Acts upstream of or within T cell mediated cytotoxicity. Predicted to be located in intracellular membrane-bounded organelle and plasma membrane. Predicted to be active in external side of plasma membrane and extracellular space. Is expressed in embryo; embryo endoderm; and midgut. Orthologous to human RAET1G (retinoic acid early transcript 1G) and RAET1L (retinoic acid early transcript 1L).
Source : Insect cells
Species : Mouse
Tag : C-His
Form : Liquid
Molecular Weight : 23.5 kDa (207aa)
AA Sequence : LDDAHSLRCNLTIKDPTSADLPWCDVKCSVDEITILHLNNINKTMTSGDPGKMANATGKCLTQPLNDLCQELRDKVSNTKVDTHKTNGYPHLQVTMIYPQSQGQTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGDLVQQLKYFIPQCRQKIDEFLKQSKEKPRSTSRSPSITQLTSTSPLPPPSHSLEHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Reference : 1. Diefenbach A., et al. (2000) Nat Immunol. 1:119-126.
2. Cerwenka A., et al. (2001) Proc Natl Acad Sci USA. 98:11521-11526.
Gene Name Raet1e retinoic acid early transcript 1E [ Mus musculus (house mouse) ]
Official Symbol Raet1e
Synonyms RAET1E; retinoic acid early transcript 1E; retinoic acid early-inducible protein 1-epsilon; RAE-1-epsilon; Rae-1 epsilon
Gene ID 379043
mRNA Refseq NM_198193
Protein Refseq NP_937836
UniProt ID Q9CZQ6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Raet1e Products

Required fields are marked with *

My Review for All Raet1e Products

Required fields are marked with *

0
cart-icon
0
compare icon