Recombinant Mouse Raet1e Protein, His tagged

• Cat.No.: Raet1e-02M
• Product Overview: Recombinant mouse Raet1e (29-227 aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: Insect cells
• Tag: His
• Protein Length: 29-227 aa
• Description: Enables natural killer cell lectin-like receptor binding activity. Acts upstream of or within T cell mediated cytotoxicity. Predicted to be located in intracellular membrane-bounded organelle and plasma membrane. Predicted to be active in external side of plasma membrane and extracellular space. Is expressed in embryo; embryo endoderm; and midgut. Orthologous to human RAET1G (retinoic acid early transcript 1G) and RAET1L (retinoic acid early transcript 1L).
• Source: Insect cells
• Species: Mouse
• Tag: C-His
• Form: Liquid
• Molecular Weight: 23.5 kDa (207aa)
• AA Sequence: LDDAHSLRCNLTIKDPTSADLPWCDVKCSVDEITILHLNNINKTMTSGDPGKMANATGKCLTQPLNDLCQELRDKVSNTKVDTHKTNGYPHLQVTMIYPQSQGQTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGDLVQQLKYFIPQCRQKIDEFLKQSKEKPRSTSRSPSITQLTSTSPLPPPSHSLEHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
• Concentration: 0.5 mg/mL (determined by absorbance at 280nm)
• Reference: 1. Diefenbach A., et al. (2000) Nat Immunol. 1:119-126.
  2. Cerwenka A., et al. (2001) Proc Natl Acad Sci USA. 98:11521-11526.

Gene Information

• Gene Name: Raet1e retinoic acid early transcript 1E [ Mus musculus (house mouse) ]
• Official Symbol: Raet1e
• Synonyms: RAET1E; retinoic acid early transcript 1E; retinoic acid early-inducible protein 1-epsilon; RAE-1-epsilon; Rae-1 epsilon
• Gene ID: 379043
• mRNA Refseq: NM_198193
• Protein Refseq: NP_937836
• UniProt ID: Q9CZQ6