Recombinant Human RAGE protein, GST-tagged

Cat.No. : RAGE-2163H
Product Overview : Recombinant Human RAGE (1-231aa) fussed with GST tag at N-terminal was expressed in E. coli.
Availability July 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-231aa
Form : 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
Molecular Mass : 53 kDa
AA Sequence : MKNYKAIGKIGEGTFSEVMKMQSLRDGNYYACKQMKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKS GSLALICELMDMNIYELIRGRRYPLSEKKIMHYMYQLCKSLDHIHRNGIFHRDVKPENILIKQDVLKLGDFGSCR SVYSKQPYTEYISTRWYRAPECLLTDGFYTYKMDLWSAGCVFYEIASLQPLFPGVNELDQISKIHDVIGTPAQKI LTKFKQ
Stability : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Shipping : The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name AGER advanced glycosylation end product-specific receptor [ Homo sapiens ]
Official Symbol AGER
Synonyms AGER; advanced glycosylation end product-specific receptor; RAGE; RAGE isoform sRAGE-delta; RAGE isoform NtRAGE-delta;
Gene ID 177
mRNA Refseq NM_001136
Protein Refseq NP_001127
MIM 600214
UniProt ID Q15109
Chromosome Location 6p21.3
Pathway Activated TLR4 signalling, organism-specific biosystem; Advanced glycosylation endproduct receptor signaling, organism-specific biosystem; Cytosolic sensors of pathogen-associated DNA, organism-specific biosystem; DAI mediated induction of type I IFNs, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; MyD88 cascade initiated on plasma membrane, organism-specific biosystem;
Function S100 alpha binding; advanced glycation end-product receptor activity; protein binding; receptor activity; receptor activity; transmembrane signaling receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AGER Products

Required fields are marked with *

My Review for All AGER Products

Required fields are marked with *

0
cart-icon