Recombinant Human RAGE protein, GST-tagged
| Cat.No. : | RAGE-2163H |
| Product Overview : | Recombinant Human RAGE (1-231aa) fussed with GST tag at N-terminal was expressed in E. coli. |
| Availability | December 25, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-231aa |
| Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol. |
| Molecular Mass : | 53 kDa |
| AA Sequence : | MKNYKAIGKIGEGTFSEVMKMQSLRDGNYYACKQMKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKS GSLALICELMDMNIYELIRGRRYPLSEKKIMHYMYQLCKSLDHIHRNGIFHRDVKPENILIKQDVLKLGDFGSCR SVYSKQPYTEYISTRWYRAPECLLTDGFYTYKMDLWSAGCVFYEIASLQPLFPGVNELDQISKIHDVIGTPAQKI LTKFKQ |
| Stability : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
| Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
| Gene Name | AGER advanced glycosylation end product-specific receptor [ Homo sapiens ] |
| Official Symbol | AGER |
| Synonyms | AGER; advanced glycosylation end product-specific receptor; RAGE; RAGE isoform sRAGE-delta; RAGE isoform NtRAGE-delta; |
| Gene ID | 177 |
| mRNA Refseq | NM_001136 |
| Protein Refseq | NP_001127 |
| MIM | 600214 |
| UniProt ID | Q15109 |
| Chromosome Location | 6p21.3 |
| Pathway | Activated TLR4 signalling, organism-specific biosystem; Advanced glycosylation endproduct receptor signaling, organism-specific biosystem; Cytosolic sensors of pathogen-associated DNA, organism-specific biosystem; DAI mediated induction of type I IFNs, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; MyD88 cascade initiated on plasma membrane, organism-specific biosystem; |
| Function | S100 alpha binding; advanced glycation end-product receptor activity; protein binding; receptor activity; receptor activity; transmembrane signaling receptor activity; |
| ◆ Recombinant Proteins | ||
| AGER-268R | Recombinant Rhesus monkey AGER Protein, His-tagged | +Inquiry |
| AGER-7323H | Recombinant Human AGER protein | +Inquiry |
| AGER-423H | Recombinant Human AGER Protein, GST-tagged | +Inquiry |
| AGER-424C | Active Recombinant Canine AGER, His-tagged | +Inquiry |
| AGER-70H | Recombinant Human AGER Protein (Aal23-Ser120), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AGER-2546HCL | Recombinant Human RAGE 293 Cell Lysate | +Inquiry |
| AGER-1480HCL | Recombinant Human AGER cell lysate | +Inquiry |
| AGER-2215MCL | Recombinant Mouse AGER cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGER Products
Required fields are marked with *
My Review for All AGER Products
Required fields are marked with *
