Recombinant Human RB1, His-tagged
Cat.No. : | RB1-31044TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 792-928 of Human Rb with 6X His tag; 146 amino acids, 16.5 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 792-928 a.a. |
Description : | The protein encoded by this gene is a negative regulator of the cell cycle and was the first tumor suppressor gene found. The encoded protein also stabilizes constitutive heterochromatin to maintain the overall chromatin structure. The active, hypophosphorylated form of the protein binds transcription factor E2F1. Defects in this gene are a cause of childhood cancer retinoblastoma (RB), bladder cancer, and osteogenic sarcoma. |
Conjugation : | HIS |
Tissue specificity : | Expressed in the retina. |
Form : | Lyophilised:Reconstitute in sterile 18MO-cm H2O not less than 100 μg/ml, which can then be further diluted to other aqueous solutions. |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20mM PBS, pH 7.4 |
Storage : | Store at -20°C or lower.Aliquot to avoid repeated freezing and thawing. |
Sequences of amino acids : | MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPR SRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNP PKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTR TRMQKQKMNDSMDTSNKEEKHHHHHH |
Sequence Similarities : | Belongs to the retinoblastoma protein (RB) family. |
Gene Name | RB1 retinoblastoma 1 [ Homo sapiens ] |
Official Symbol | RB1 |
Synonyms | RB1; retinoblastoma 1; OSRC, osteosarcoma; retinoblastoma-associated protein; RB; |
Gene ID | 5925 |
mRNA Refseq | NM_000321 |
Protein Refseq | NP_000312 |
MIM | 614041 |
Uniprot ID | P06400 |
Chromosome Location | 13q14.2 |
Pathway | Adipogenesis, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; |
Function | DNA binding; RNA polymerase II activating transcription factor binding; androgen receptor binding; core promoter binding; kinase activity; |
◆ Recombinant Proteins | ||
RB1-0401H | Recombinant Human RB1 protein, His-tagged | +Inquiry |
RB1-4949R | Recombinant Rat RB1 Protein | +Inquiry |
RB1-701H | Recombinant Human RB1, GST-tagged | +Inquiry |
RB1-570H | Recombinant Human RB1, GST-tagged | +Inquiry |
RB1-6150H | Recombinant Human RB1 Protein (Gln639-Thr778), N-GST tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RB1 Products
Required fields are marked with *
My Review for All RB1 Products
Required fields are marked with *
0
Inquiry Basket